KEGG   Fervidicoccus fontis: FFONT_0428Help
Entry
FFONT_0428        CDS       T01936                                 

Definition
(GenBank) metalloexopeptidase, family M20
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ffo  Fervidicoccus fontis
Pathway
ffo00300  Lysine biosynthesis
ffo01100  Metabolic pathways
ffo01120  Microbial metabolism in diverse environments
ffo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ffo00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    FFONT_0428
Enzymes [BR:ffo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     FFONT_0428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AFH42418
UniProt: I0A0B1
Position
412489..413757
Genome map
AA seq 422 aa AA seqDB search
MNKTSNIPKELLDKVESLKDEMVNTLVELIKIPAISPSSGGEGELDKAKKLLEIIKKWKF
DDIIEVNAPDPRAKGGIRPNIVAIYKGKNEKDKIWFLTHMDVVPPGELSKWTECKPFEPV
VKNGKVYGRGSVDNGQSLVASLYAVKALMDLGIRPSRTVALAFVSDEETGSEYGAQYLLK
ARPDLFGENDWIVVPDGGNSEGSFIEIAEKGILWLRVKVTGKQVHGSMPDKGLNAHRVAA
DFVITLDKKLHEKFNKRNDLFDPPRSTFEPTMVRGSAGSVNIIPSDHEITFDCRILPEYT
IDEVLNVVNQTKNEIIAKHKKVIEGESLPKIEIEIVNRSDSTKPTDPNSEIVKKLTESIQ
KLRGITPKTGGIGGGTVAAFFRQKGIPAVVWCTIDEVEHQPNEYASIKNMVEDAKVFLSL
MI
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
ttgaataaaacctctaatattcccaaagaacttttagataaagttgaatcattaaaagat
gaaatggttaatactttggtagaactcataaaaattcctgcaatcagtcctagttctgga
ggagaaggagagctcgataaagctaaaaaactccttgaaattattaaaaaatggaagttc
gatgatattattgaagtcaatgctcctgacccaagagcaaaaggaggaataagaccaaat
attgttgctatttataaaggtaaaaacgaaaaagataagatctggtttttaacacatatg
gacgttgttccacctggagaattaagcaaatggacagaatgcaaaccttttgaacctgtc
gttaaaaatggaaaggtttatggcagaggatccgttgacaatgggcagtctctagtagct
tcattatacgcagtaaaagccttgatggacttgggaattagaccctctaggacagtggct
ttagcttttgtaagcgacgaagaaaccggttctgaatatggagcgcagtatttattaaaa
gccagaccagatctattcggagaaaatgattggatagtagttccagacggaggaaattct
gaaggaagctttatagaaattgcagaaaaaggtattctttggctaagagttaaggtcacc
gggaagcaggtccatggctcaatgcccgacaaaggacttaatgcccatcgtgttgctgcc
gactttgttataacattagataaaaaattgcacgaaaagtttaacaaaagaaatgattta
ttcgaccctccgaggagtacattcgaaccgactatggtaagaggttcagctggttcagtt
aatataattccctctgaccatgaaatcacttttgactgtagaatattgcctgaatatact
attgatgaagtcctaaatgtagtaaaccagacaaagaatgaaattattgcaaaacacaaa
aaagtcattgagggagaaagtctacccaaaattgaaattgaaattgttaatcgcagtgat
tctacaaagccaacagatccaaacagtgaaatagtgaaaaagctaacagaatcgatacaa
aaattgaggggcattacaccgaaaacaggcggaataggtggaggtacagtagcggcattc
ttcagacaaaaaggaatccctgctgtagtttggtgcactatcgatgaagttgaacatcag
ccaaatgaatatgcttcaataaagaatatggtcgaagatgcgaaagtcttcctttcacta
atgatataa

DBGET integrated database retrieval system