KEGG   Fervidicoccus fontis: FFONT_0469Help
Entry
FFONT_0469        CDS       T01936                                 

Definition
(GenBank) metalloexopeptidase, family M42
Organism
ffo  Fervidicoccus fontis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(444534..445637)
Genome map
AA seq 367 aa AA seqDB search
MQNFNKDEYKKCLRKYSQANGPSGMEDEVRDLLIEDLKPYADRIWIDSMGNVISLKKGVS
GKKLMIAAHMDEISLIVKYIDDNGFLRFSPVGGWSERILPATRVKVRTNKGDWIPGVIGV
KPPHLITPEEEKKVIEMNKLFIDVGASSRQEALSMGIEHGSRVLLDYDFADLIGNRVTGK
AFDDRAGLVVALKTFMEVEPNDIDLYFVATVQEEVGLKGARTSAYQISPDVAIALDVTTA
NDVPDVDEQDQVAKLGKGPAIKIIDGRSGSGLITNTAVLEKMISVAKERGIPYQAEVLTG
GTTDSSAIQLTKEGVPAGTISIPARYIHSPVEVIDLVDIHYSVELLKAFYESLKPEWIDS
IKEKIIK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcagaattttaacaaagacgaatacaaaaaatgtttaagaaaatattctcaggcaaat
ggtccaagcggtatggaagatgaagtaagagatctgttaattgaagatttgaagccgtat
gctgataggatatggattgatagcatgggaaatgtgatatcgcttaagaaaggtgtaagc
gggaaaaaactgatgattgctgcgcatatggatgagatttccttaatagttaaatacata
gatgataacggatttctaagattctctccagtaggagggtggagtgaaagaatacttccc
gcgactagggtaaaagtcagaacaaataaaggcgattggattcctggagttataggcgtt
aagccacctcatctaataactcctgaagaggagaagaaagttattgagatgaacaagctg
tttatagatgtaggggcatcatcgaggcaggaagcattgtccatgggaattgaacacggc
tctagagtgttgcttgattacgatttcgccgatttgataggtaatagggtaacagggaaa
gcttttgacgacagagctggattggttgtcgctttaaaaacgtttatggaagttgagcca
aatgacatagatctttattttgttgcaactgttcaagaagaagttggattaaaaggagca
agaacaagtgcatatcaaatatctccagatgtagctatagccttagatgtaaccacggca
aatgacgttccagatgtggatgagcaggatcaggttgctaaattgggcaaaggtcctgca
ataaaaataattgatggaagaagcggttctgggctaataaccaacactgctgttctcgaa
aaaatgatatctgtagcgaaagagcgcggaataccttatcaggcagaagttctcactggg
ggaacaacggactcctcagcaattcaactaactaaagagggagttccagctgggactata
agcatacctgcaagatatattcatagtccagttgaggtcatcgatcttgtcgatattcat
tatagcgttgagctccttaaggctttttatgaaagcttaaagcctgagtggattgatagt
ataaaggagaagataatcaaatga

DBGET integrated database retrieval system