KEGG   Fervidicoccus fontis: FFONT_0469Help
Entry
FFONT_0469        CDS       T01936                                 

Definition
metalloexopeptidase, family M42
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ffo  Fervidicoccus fontis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ffo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FFONT_0469
Enzymes [BR:ffo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     FFONT_0469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(444534..445637)
Genome map
AA seq 367 aa AA seqDB search
MQNFNKDEYKKCLRKYSQANGPSGMEDEVRDLLIEDLKPYADRIWIDSMGNVISLKKGVS
GKKLMIAAHMDEISLIVKYIDDNGFLRFSPVGGWSERILPATRVKVRTNKGDWIPGVIGV
KPPHLITPEEEKKVIEMNKLFIDVGASSRQEALSMGIEHGSRVLLDYDFADLIGNRVTGK
AFDDRAGLVVALKTFMEVEPNDIDLYFVATVQEEVGLKGARTSAYQISPDVAIALDVTTA
NDVPDVDEQDQVAKLGKGPAIKIIDGRSGSGLITNTAVLEKMISVAKERGIPYQAEVLTG
GTTDSSAIQLTKEGVPAGTISIPARYIHSPVEVIDLVDIHYSVELLKAFYESLKPEWIDS
IKEKIIK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcagaattttaacaaagacgaatacaaaaaatgtttaagaaaatattctcaggcaaat
ggtccaagcggtatggaagatgaagtaagagatctgttaattgaagatttgaagccgtat
gctgataggatatggattgatagcatgggaaatgtgatatcgcttaagaaaggtgtaagc
gggaaaaaactgatgattgctgcgcatatggatgagatttccttaatagttaaatacata
gatgataacggatttctaagattctctccagtaggagggtggagtgaaagaatacttccc
gcgactagggtaaaagtcagaacaaataaaggcgattggattcctggagttataggcgtt
aagccacctcatctaataactcctgaagaggagaagaaagttattgagatgaacaagctg
tttatagatgtaggggcatcatcgaggcaggaagcattgtccatgggaattgaacacggc
tctagagtgttgcttgattacgatttcgccgatttgataggtaatagggtaacagggaaa
gcttttgacgacagagctggattggttgtcgctttaaaaacgtttatggaagttgagcca
aatgacatagatctttattttgttgcaactgttcaagaagaagttggattaaaaggagca
agaacaagtgcatatcaaatatctccagatgtagctatagccttagatgtaaccacggca
aatgacgttccagatgtggatgagcaggatcaggttgctaaattgggcaaaggtcctgca
ataaaaataattgatggaagaagcggttctgggctaataaccaacactgctgttctcgaa
aaaatgatatctgtagcgaaagagcgcggaataccttatcaggcagaagttctcactggg
ggaacaacggactcctcagcaattcaactaactaaagagggagttccagctgggactata
agcatacctgcaagatatattcatagtccagttgaggtcatcgatcttgtcgatattcat
tatagcgttgagctccttaaggctttttatgaaagcttaaagcctgagtggattgatagt
ataaaggagaagataatcaaatga

DBGET integrated database retrieval system