KEGG   Fervidicoccus fontis: FFONT_0604Help
Entry
FFONT_0604        CDS       T01936                                 

Definition
Aldehyde:ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
ffo  Fervidicoccus fontis
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ffo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FFONT_0604
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    FFONT_0604
Enzymes [BR:ffo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     FFONT_0604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
568098..569969
Genome map
AA seq 623 aa AA seqDB search
MSPNSIYGYAGKILWLDLTKREAKKLELSREMARDYIGARGFGIKILWDNMKKGTDPLSP
ESLLVVSVGPLAGTSSQSASRWFVVFKSPLTGTYFRSVGGGYFGAEMKFAGYDAIVVSGR
AEKPTYVWIKDDNVEFRDATRAWGLTTNMTTELLKEETDKSARLITIGPAGERLVKISSI
QSDDQRSAGRGGGGAVLGAKNLKAIVVKGSKMPKLFDEERFREAVKEEIQTYQKSPALEG
FRALGTAGVVDLFYSLGHNPSFNFMQREFNGIDNYKADVFPRYIIKRGGCYGCMISCWQF
LKTTDGPYAGFFWDKPEYEALWSFGSNLGNANLEAVMQANMLCDKYGLDVISVGSAIGMA
YELYEKGILTRKETDGMELRWGDPEPALEIIRKIALREGIGRILGEGTKRAAEIIGRGAE
KYAIQIKGLELPAYDPRAAKAHGLSLVTSNIGASHNMGWNYFEITGVPKDGKQVDPLSIE
GKGELTKYVQDETAMYEVAGKCTFPADFVMFTRENLAKLLYYATGIEEFKNPDYLMLVGE
RVYNLERAFNVREGFGREHDTIPERFVKEPFPRTPAKGQVFELDKLLDDYYKARGWDLKT
GKPTKAKLESLGLNDVAKEINAE
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgtctccaaattcaatatacggatacgctggaaaaattttatggttagatttaacgaaa
agagaggcgaaaaagctagagcttagcagagaaatggcaagagattatattggcgctagg
ggatttggtataaaaattctatgggacaatatgaaaaaaggaactgatcccctcagcccg
gaaagcttgttagttgtatcagtaggtcctttggccggaacctcttctcagagtgcgagt
aggtggtttgtagtattcaaatcaccattaactggaacgtacttcagaagtgttggggga
gggtacttcggtgcagagatgaagtttgcgggttatgatgcaatagtcgtaagcggaaga
gctgagaagcccacttacgtttggataaaagatgataatgtcgagttcagggatgccacg
agggcttggggcctaaccacaaacatgacgactgagcttttaaaagaggaaacggacaag
agcgcgaggctcattactataggtcctgcaggagagaggttggtgaagatctcctctatt
cagagtgacgaccagaggagcgcaggaagaggtggaggaggtgcagtgcttggagcaaag
aacttgaaggctatagtggttaaaggctcaaagatgccgaagctatttgatgaggagagg
ttcagagaagcagtaaaggaagaaattcagacgtatcaaaagagccctgcacttgaagga
tttagggcccttggaactgcgggagtagtcgatctattttattctttggggcataacccg
agcttcaacttcatgcagagggaattcaacggaatagataattataaagctgatgtattt
ccaaggtatattattaaaaggggaggctgctatggatgcatgataagctgctggcagttc
ttgaagacaacggacggtccttatgccggcttcttttgggacaagccagaatacgaggct
ctctggtctttcggatcaaaccttggcaacgctaaccttgaagccgttatgcaggccaac
atgctctgtgataaatatgggcttgacgtaatttctgttggttcagcgattggtatggcc
tatgagctgtatgaaaaggggatcctgacgagaaaagagacggatggaatggaattgagg
tggggggatcctgagccagcgcttgaaattatcaggaaaatagcgcttagagaaggaata
ggaaggattttgggagaagggacgaagagagctgccgaaattattggcagaggtgcggaa
aagtatgcgatacaaataaaaggtctcgagttacccgcatatgacccaagggcagcaaaa
gctcacggattaagtttggtgacttcaaatattggagcaagtcataacatgggctggaac
tactttgagataactggagttccaaaggacggaaaacaggttgatccgctttcgattgag
ggaaaaggggagcttaccaagtacgtgcaggatgagaccgcaatgtatgaagttgcggga
aagtgcacattccctgcagacttcgtaatgtttacaagggagaaccttgcaaaattactt
tattatgctacaggtattgaggagttcaagaacccagactacttaatgcttgtgggagag
agagtatataacttagagagggcattcaatgtaagagagggatttggaagagagcacgac
accattcctgagaggttcgtaaaggagcctttcccgagaacacctgcgaagggacaggtg
ttcgagcttgataaattgctcgacgactactataaggcaagaggttgggacttgaagact
ggtaagccaactaaggcgaaactagagtctttaggattgaacgatgttgcaaaagagata
aacgcggagtaa

DBGET integrated database retrieval system