KEGG   Fervidicoccus fontis: FFONT_0788Help
Entry
FFONT_0788        CDS       T01936                                 

Definition
(GenBank) Pyridoxal-5'-phosphate-dependent protein beta subunit
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ffo  Fervidicoccus fontis
Pathway
ffo00260  Glycine, serine and threonine metabolism
ffo01100  Metabolic pathways
ffo01110  Biosynthesis of secondary metabolites
ffo01120  Microbial metabolism in diverse environments
ffo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ffo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FFONT_0788
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    FFONT_0788
Enzymes [BR:ffo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     FFONT_0788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PadR
Motif
Other DBs
NCBI-ProteinID: AFH42776
UniProt: I0A1B9
Position
complement(745457..746596)
Genome map
AA seq 379 aa AA seqDB search
MIALLKGLKTICPSNNEEYDGIVLSDSRCDSPLMIEIGGAEWKVLHDVPSIWRYSNLMPK
FSETVTRGEGFTPLRRWSEKDIYLKLEGFNPTGTYMDRGSSVLASFFKTYKPNDSAIIRY
SKDFAISAATYLTPSHRTKVVIEDPLKADPEELTSLVYLNAELCTERYREAISYDNPLTI
EGLKTIIFEIVERGITEGKILVPSESGVLALSIWKGIKDLEKANFETNFKIIAAVLEDNY
PSYLKNIEGIQIEKIKLNELIDNFIELTRKGVKVKLVSALGVALAMKLGEGIVIVTGESK
GVNLRGSQSFWNDIKKDIAKALEGKKGMTAYEIWRELKEKYTLRGIYKALESLEAEGIVI
SFFEMRKNKKVRKYSLFPS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgattgccttgttgaaaggattgaaaactatatgtccatctaataacgaagaatacgat
ggaattgtgttatcagatagtagatgcgattctcctttaatgattgaaattgggggtgcc
gaatggaaggttcttcacgatgttccaagcatatggagatatagcaatctcatgcctaaa
tttagtgaaactgtcactagaggggaaggttttacaccgcttagaaggtggtcagaaaaa
gatatctacttaaagctagaaggattcaatcctactggaacttatatggatcgagggtca
tctgtattggccagctttttcaaaacttataagccaaacgattctgctattataagatac
tctaaagattttgctatatctgctgcaacttatctaacaccttctcacagaacaaaagta
gttatcgaagaccctcttaaagcagatcctgaagagcttacatcgctagtgtatttaaat
gcagaactgtgcacagaaagatacagagaggctataagctatgacaatccgctaaccatt
gaagggctgaaaacaatcatttttgaaatagtagaaagggggataaccgagggaaaaatt
ctcgtgccaagtgaatcgggagtcctcgctttatctatatggaaagggataaaggattta
gagaaagcaaactttgaaacgaattttaagatcattgcagcagtccttgaagataactat
ccttcctatctaaaaaatattgaaggaattcaaattgaaaagatcaaactaaatgagctt
atagacaattttattgaactcaccagaaaaggagtaaaagtaaagttagtatctgcacta
ggcgtagctttagctatgaagcttggagaaggtatagtaatagtaacaggagagtctaaa
ggagtaaacctgagaggttcccaaagcttttggaatgatattaaaaaagatatagcaaaa
gctttggaaggtaaaaaagggatgaccgcttatgagatctggagggagcttaaggaaaaa
tacactcttcgtgggatctataaagctttagaaagtttagaagctgaaggaattgttatt
tcgttttttgaaatgagaaaaaataaaaaagtcaggaaatattcgttgtttccttcataa

DBGET integrated database retrieval system