KEGG   Fervidicoccus fontis: FFONT_0788Help
Entry
FFONT_0788        CDS       T01936                                 

Definition
pyridoxal-5'-phosphate-dependent protein subunit beta
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ffo  Fervidicoccus fontis
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ffo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FFONT_0788
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FFONT_0788
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    FFONT_0788
Enzymes [BR:ffo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     FFONT_0788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(745457..746596)
Genome map
AA seq 379 aa AA seqDB search
MIALLKGLKTICPSNNEEYDGIVLSDSRCDSPLMIEIGGAEWKVLHDVPSIWRYSNLMPK
FSETVTRGEGFTPLRRWSEKDIYLKLEGFNPTGTYMDRGSSVLASFFKTYKPNDSAIIRY
SKDFAISAATYLTPSHRTKVVIEDPLKADPEELTSLVYLNAELCTERYREAISYDNPLTI
EGLKTIIFEIVERGITEGKILVPSESGVLALSIWKGIKDLEKANFETNFKIIAAVLEDNY
PSYLKNIEGIQIEKIKLNELIDNFIELTRKGVKVKLVSALGVALAMKLGEGIVIVTGESK
GVNLRGSQSFWNDIKKDIAKALEGKKGMTAYEIWRELKEKYTLRGIYKALESLEAEGIVI
SFFEMRKNKKVRKYSLFPS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgattgccttgttgaaaggattgaaaactatatgtccatctaataacgaagaatacgat
ggaattgtgttatcagatagtagatgcgattctcctttaatgattgaaattgggggtgcc
gaatggaaggttcttcacgatgttccaagcatatggagatatagcaatctcatgcctaaa
tttagtgaaactgtcactagaggggaaggttttacaccgcttagaaggtggtcagaaaaa
gatatctacttaaagctagaaggattcaatcctactggaacttatatggatcgagggtca
tctgtattggccagctttttcaaaacttataagccaaacgattctgctattataagatac
tctaaagattttgctatatctgctgcaacttatctaacaccttctcacagaacaaaagta
gttatcgaagaccctcttaaagcagatcctgaagagcttacatcgctagtgtatttaaat
gcagaactgtgcacagaaagatacagagaggctataagctatgacaatccgctaaccatt
gaagggctgaaaacaatcatttttgaaatagtagaaagggggataaccgagggaaaaatt
ctcgtgccaagtgaatcgggagtcctcgctttatctatatggaaagggataaaggattta
gagaaagcaaactttgaaacgaattttaagatcattgcagcagtccttgaagataactat
ccttcctatctaaaaaatattgaaggaattcaaattgaaaagatcaaactaaatgagctt
atagacaattttattgaactcaccagaaaaggagtaaaagtaaagttagtatctgcacta
ggcgtagctttagctatgaagcttggagaaggtatagtaatagtaacaggagagtctaaa
ggagtaaacctgagaggttcccaaagcttttggaatgatattaaaaaagatatagcaaaa
gctttggaaggtaaaaaagggatgaccgcttatgagatctggagggagcttaaggaaaaa
tacactcttcgtgggatctataaagctttagaaagtttagaagctgaaggaattgttatt
tcgttttttgaaatgagaaaaaataaaaaagtcaggaaatattcgttgtttccttcataa

DBGET integrated database retrieval system