KEGG   Fervidicoccus fontis: FFONT_0900Help
Entry
FFONT_0900        CDS       T01936                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ffo  Fervidicoccus fontis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ffo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FFONT_0900
   01230 Biosynthesis of amino acids
    FFONT_0900
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FFONT_0900
   00051 Fructose and mannose metabolism
    FFONT_0900
   00562 Inositol phosphate metabolism
    FFONT_0900
Enzymes [BR:ffo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     FFONT_0900
Exosome [BR:ffo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   FFONT_0900
  Exosomal proteins of bladder cancer cells
   FFONT_0900
  Exosomal proteins of melanoma cells
   FFONT_0900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
850316..851011
Genome map
AA seq 231 aa AA seqDB search
MLPANKPIFVINYKAYETSYGHQALLIAKASEKAELEFSIKTIIAVPFTEIWRISKEVSI
DVIAQHVDPIIPGQGTGFITAEMIAGSGGKGSILNHSEHKLKIFEIEKGIERLKLNNLYS
IVCAETPRSSLAVANLGADIVAMEPPDLIGTGVSVSKSKPELVTKTVEKIRNSGFKKIPI
LVGAGIVDKEDARKAIKLGADGILVSSIIMKSKEPEKKIFELAEGLNSLNK
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgttgccagctaataaacctatatttgtcattaattataaggcatatgaaacgagctat
ggacatcaagctttattaattgcaaaagcatctgaaaaagcggagttagaatttagtata
aaaacgataatagcggttccctttactgaaatatggagaatttctaaagaagtgtcaata
gatgttatcgctcagcacgttgatccaataatacctggtcaaggaacaggctttataaca
gcagaaatgatcgctggttcaggggggaaaggatcaattcttaatcacagtgaacataag
ctgaaaatttttgaaatcgaaaaaggaatagaaaggcttaagctaaataacttatacagt
atagtttgtgcagagactccaagatcttcgcttgcagttgcaaacctcggtgcagatatc
gttgcaatggaaccaccagatcttataggaacaggagtaagcgtttcaaaatctaaacct
gaactagttactaaaacggttgaaaaaatacgaaattctggttttaaaaaaattccaatt
cttgttggtgctggtatagttgataaagaggacgcaagaaaagccattaagctaggtgct
gatggaattcttgtttcaagcataataatgaaatcaaaagaaccagaaaaaaagatattt
gagcttgctgaaggattaaatagtttaaacaaataa

DBGET integrated database retrieval system