KEGG   Fervidicoccus fontis: FFONT_0932Help
Entry
FFONT_0932        CDS       T01936                                 

Definition
(RefSeq) 2-oxoacid:ferredoxin oxidoreductase, fused gamma and delta subunits
Organism
ffo  Fervidicoccus fontis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
887521..888645
Genome map
AA seq 374 aa AA seqDB search
MKFTPKIERYFDYEKLDWIISHGIGVDHTADMTAFSQTLAQVGALKGIETYYYMRYDDSP
ERNYIPMIFYTVFGNPNVPVLLHEEVEPVGELFNVIAVFSSSLLLQKTSQRALLFDGAKK
NAILVVNTSISPDDVVKLVKKYNLAQDWFGRVVTISAARIDSAIAYPMLGAVASAWDRVD
LDSLLAAADIFGKEKKKESIRKGYENSSVKEVHILAEETEMFKKIKNEIELPEYTGEFWT
PEVYYTYQKAAAEAQTYSSRIASMPRWEVLAPGLIEFGPKPGNKNIGFTTQWRWQRPIID
YKRCTDCKLCHYYCPDGAISFNPIKIDYDYCKGCGICANVCPAKAISMVSELEHLEGLKD
REVLRRFDQREYGF
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattcacaccaaaaatagaaaggtattttgattatgaaaaacttgattggattata
tcacacggaataggcgtcgatcataccgcagatatgacggctttttcgcaaactttagct
caagtaggagcactcaagggaattgagacatattactacatgaggtatgacgacagccct
gaaaggaactacattcccatgatcttttatacggtgtttggcaatccaaatgttcctgtg
cttcttcacgaagaggttgagcctgttggcgaacttttcaatgttattgcagtttttagc
tcaagtctcctgcttcaaaagacatctcaaagggctcttttattcgatggcgcaaagaag
aatgctatacttgttgtaaacacatcgatatctcctgatgacgtagtcaagctagttaaa
aaatacaatctagcacaagactggttcggaagggttgtaactataagcgcggctaggata
gattctgctattgcctatcctatgctaggagcagtagcaagtgcttgggacagagttgac
ctagattctctgcttgctgcggctgatatatttggtaaagagaaaaagaaagaatctata
agaaagggttacgaaaattcgtcagtcaaagaggtccatatacttgctgaggagacagag
atgtttaagaaaataaagaacgaaatcgaacttcctgaatatactggagagttctggact
ccagaagtctactatacatatcagaaggcagcagccgaagctcaaacatactcttcaaga
atagcttcaatgcctaggtgggaagtcttagcacctggtttgatcgagtttggtccaaag
cctggaaataaaaacatcggctttacgactcaatggaggtggcagagacccattattgat
tataagagatgcacagattgcaaactatgccactactattgccctgatggcgcaatcagt
ttcaatccaataaagatcgactatgattattgcaagggctgtggcatttgtgctaatgta
tgccccgcaaaggctataagtatggtatcggaacttgagcatcttgaaggcttaaaggat
agagaggtgcttaggagatttgaccaaagagagtacggattctga

DBGET integrated database retrieval system