KEGG   Fervidicoccus fontis: FFONT_0961Help
Entry
FFONT_0961        CDS       T01936                                 

Definition
fructose-1,6-bisphosphate phosphatase (type V)
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
ffo  Fervidicoccus fontis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ffo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FFONT_0961
   01230 Biosynthesis of amino acids
    FFONT_0961
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FFONT_0961
   00030 Pentose phosphate pathway
    FFONT_0961
   00051 Fructose and mannose metabolism
    FFONT_0961
  Energy metabolism
   00680 Methane metabolism
    FFONT_0961
Enzymes [BR:ffo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     FFONT_0961
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     FFONT_0961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(916168..917268)
Genome map
AA seq 366 aa AA seqDB search
MSTGKKVTLSIIKADVGGLAGHHVVHPDLIATATRMLSEAKESGIIEDFYVTNVGDDLQL
IMTHYRGVDSKDVHSLAWDTFKEATKVAQKLGLYGAGQDLLSDAFSGNVRGMGPGVAEME
FIERTSEPVVAFMADKTEPGAFNLPFYKIYADPFNTAGLVIDPKLHSGFKFEIWDLIEHK
QYFLNAPEDSYDILALIGTTGRFTIKRVYRKDNNEIAAAVSSERLNLIAGKYVGKDDPVA
IARAQSGFPALGEILEPFSFPHLVAGWMRGSHNGPLMPVSQKDARCTRFDGPPRIIALGF
NIKDGKLIGPTDLFDDPAFDETRRTAQIIADYMRRHGPFMPHRLGPEEMEYTTLPQVLKK
LEEKKI
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgagcactggtaaaaaagttacattgagcattataaaagcagatgtaggcggtcttgct
ggacaccatgtagtgcatcccgacctaatagcaacagccactagaatgctttcagaagca
aaagagagcggaataatagaagatttctatgtcactaatgttggtgatgatctgcaactc
ataatgacacactacagaggcgtggatagcaaagatgttcactcgttagcgtgggatact
ttcaaagaagcgacaaaagttgcacaaaagctaggtctttatggagctggtcaggatttg
ttgagtgatgcattttccggaaatgtaagaggcatgggtccaggcgtagcggaaatggaa
tttatcgaaagaactagtgaacctgtcgttgcttttatggcagataaaactgaacctggt
gcatttaaccttccattttacaagatctatgctgatccatttaatacagctgggcttgtc
atagatcctaagttacacagtggtttcaaatttgaaatttgggatctaattgaacataaa
cagtatttcttgaatgctccagaagattcttatgacatattggcgcttatcggaacaacc
ggtagatttactataaaaagagtttacagaaaagataataatgagattgcagctgcagta
agtagcgaaagacttaacctaattgcaggaaaatatgtaggaaaggacgaccctgttgct
atagcgagagctcagtcgggatttccagctttaggagaaatactagagccattttcattt
ccacatctagtagccggatggatgagaggtagccataatggacctttaatgccagtctct
caaaaagatgccagatgtactagatttgatggtcctccgagaataatagcattaggcttc
aatataaaagatggaaagcttataggtccaactgacctatttgatgatcctgcgtttgat
gaaaccagaagaacagcccagataatagccgattatatgagaaggcatggacctttcatg
ccacatagattagggccagaagaaatggaatataccactcttcctcaagttttgaaaaag
ttagaagaaaagaaaatctaa

DBGET integrated database retrieval system