KEGG   Fervidicoccus fontis: FFONT_0961Help
Entry
FFONT_0961        CDS       T01936                                 

Definition
(GenBank) fructose-1,6-bisphosphate phosphatase (type V)
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
ffo  Fervidicoccus fontis
Pathway
ffo00010  Glycolysis / Gluconeogenesis
ffo00030  Pentose phosphate pathway
ffo00051  Fructose and mannose metabolism
ffo00680  Methane metabolism
ffo01100  Metabolic pathways
ffo01110  Biosynthesis of secondary metabolites
ffo01120  Microbial metabolism in diverse environments
ffo01130  Biosynthesis of antibiotics
ffo01200  Carbon metabolism
ffo01230  Biosynthesis of amino acids
Module
ffo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ffo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FFONT_0961
   00030 Pentose phosphate pathway
    FFONT_0961
   00051 Fructose and mannose metabolism
    FFONT_0961
  Energy metabolism
   00680 Methane metabolism
    FFONT_0961
Enzymes [BR:ffo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     FFONT_0961
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     FFONT_0961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: AFH42949
UniProt: I0A1U2
Position
complement(916168..917268)
Genome map
AA seq 366 aa AA seqDB search
MSTGKKVTLSIIKADVGGLAGHHVVHPDLIATATRMLSEAKESGIIEDFYVTNVGDDLQL
IMTHYRGVDSKDVHSLAWDTFKEATKVAQKLGLYGAGQDLLSDAFSGNVRGMGPGVAEME
FIERTSEPVVAFMADKTEPGAFNLPFYKIYADPFNTAGLVIDPKLHSGFKFEIWDLIEHK
QYFLNAPEDSYDILALIGTTGRFTIKRVYRKDNNEIAAAVSSERLNLIAGKYVGKDDPVA
IARAQSGFPALGEILEPFSFPHLVAGWMRGSHNGPLMPVSQKDARCTRFDGPPRIIALGF
NIKDGKLIGPTDLFDDPAFDETRRTAQIIADYMRRHGPFMPHRLGPEEMEYTTLPQVLKK
LEEKKI
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgagcactggtaaaaaagttacattgagcattataaaagcagatgtaggcggtcttgct
ggacaccatgtagtgcatcccgacctaatagcaacagccactagaatgctttcagaagca
aaagagagcggaataatagaagatttctatgtcactaatgttggtgatgatctgcaactc
ataatgacacactacagaggcgtggatagcaaagatgttcactcgttagcgtgggatact
ttcaaagaagcgacaaaagttgcacaaaagctaggtctttatggagctggtcaggatttg
ttgagtgatgcattttccggaaatgtaagaggcatgggtccaggcgtagcggaaatggaa
tttatcgaaagaactagtgaacctgtcgttgcttttatggcagataaaactgaacctggt
gcatttaaccttccattttacaagatctatgctgatccatttaatacagctgggcttgtc
atagatcctaagttacacagtggtttcaaatttgaaatttgggatctaattgaacataaa
cagtatttcttgaatgctccagaagattcttatgacatattggcgcttatcggaacaacc
ggtagatttactataaaaagagtttacagaaaagataataatgagattgcagctgcagta
agtagcgaaagacttaacctaattgcaggaaaatatgtaggaaaggacgaccctgttgct
atagcgagagctcagtcgggatttccagctttaggagaaatactagagccattttcattt
ccacatctagtagccggatggatgagaggtagccataatggacctttaatgccagtctct
caaaaagatgccagatgtactagatttgatggtcctccgagaataatagcattaggcttc
aatataaaagatggaaagcttataggtccaactgacctatttgatgatcctgcgtttgat
gaaaccagaagaacagcccagataatagccgattatatgagaaggcatggacctttcatg
ccacatagattagggccagaagaaatggaatataccactcttcctcaagttttgaaaaag
ttagaagaaaagaaaatctaa

DBGET integrated database retrieval system