KEGG   Fervidicoccus fontis: FFONT_1169Help
Entry
FFONT_1169        CDS       T01936                                 

Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ffo  Fervidicoccus fontis
Pathway
ffo00260  Glycine, serine and threonine metabolism
ffo01100  Metabolic pathways
ffo01110  Biosynthesis of secondary metabolites
ffo01120  Microbial metabolism in diverse environments
ffo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ffo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FFONT_1169
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    FFONT_1169
Enzymes [BR:ffo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     FFONT_1169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Zn-ribbon_8 PhnA_Zn_Ribbon Rubredoxin HypA DZR zf-ribbon_3 OrfB_Zn_ribbon zf-C3HC4_3 zinc_ribbon_2 zinc-ribbons_6 DNA_RNApol_7kD Prok-RING_1 ADK_lid FYDLN_acid DUF1610
Motif
Other DBs
NCBI-ProteinID: AFH43157
UniProt: I0A2F0
Position
complement(1115670..1116692)
Genome map
AA seq 340 aa AA seqDB search
MEGYTFICPKCGKEFEDAPKDWKCPYCGSSLNLAKKPKIFRYRIMGEGNTPLVKEKIGGK
ELFFKLEYLNPTGSFKDRGTSATVQYFLKKKCSSFIEDSSGNTGISTAVYARRVNRESYI
FSPKTIAESKKKLLNLLGAKLTITETREEAFNLAVKMAKKYENACYIGHMVNPIFNYGMS
FLVEEVLKKTIGITDVIVPLASGTLLLGIFEGFKRNIDKNGGLPKIWAVQPTRTGYLRGK
VKIVHESQGRSDSADALVVSNPARINDIINAINETKGGGIIVDDEDIKEGMRNLYSRGFI
VEPSSSVVWKAFELLNREELIGSKILIPLTGSGLKYLHSI
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggaaggctatacatttatctgcccaaaatgcggaaaggagttcgaggatgcgcctaaa
gattggaaatgtccttattgtggttcttcgctaaacttggccaagaagcccaagatattt
agatataggatcatgggagaaggaaatacgccgcttgtaaaggaaaagataggaggaaaa
gaactcttttttaagcttgaatatttgaatcccacaggaagctttaaagatagaggaaca
tcagctacagtgcaatactttttgaagaaaaaatgctcatcttttattgaagactcttct
ggaaatacaggaataagcacagctgtttacgcaagaagggtcaatagagaatcctatatt
ttttccccaaaaactatagctgaatctaagaaaaaacttttaaaccttctcggtgcaaag
ctcacgataactgagacaagggaggaagcctttaatcttgcagtaaaaatggcaaaaaaa
tatgaaaatgcgtgctacatagggcacatggtaaatccaatattcaactatggaatgtca
tttttagtagaagaagtgctcaagaaaacaattggcataactgacgttattgttccactt
gcttcaggaactctattgcttggaatatttgagggctttaagagaaatatcgataagaac
ggaggattgcctaagatttgggctgttcagccgactagaaccggctatttgaggggaaaa
gtaaaaattgtacatgaatctcaaggaagaagcgattctgcagacgcgcttgttgttagc
aatcctgcaagaatcaatgatataatcaatgcaataaatgaaactaaaggaggaggtata
atcgtagatgatgaagatataaaagaaggaatgaggaatctctacagtagagggtttatt
gtcgagccttcgagttcggtagtgtggaaggcttttgagttacttaacagagaagaattg
ataggtagtaaaattcttattccattaacgggttcaggactaaagtatcttcattcaatt
tga

DBGET integrated database retrieval system