KEGG   Fervidicoccus fontis: FFONT_1207Help
Entry
FFONT_1207        CDS       T01936                                 

Definition
(GenBank) 2-oxoacid:ferredoxin oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
ffo  Fervidicoccus fontis
Pathway
ffo00010  Glycolysis / Gluconeogenesis
ffo00020  Citrate cycle (TCA cycle)
ffo00620  Pyruvate metabolism
ffo00640  Propanoate metabolism
ffo00650  Butanoate metabolism
ffo00680  Methane metabolism
ffo00720  Carbon fixation pathways in prokaryotes
ffo01100  Metabolic pathways
ffo01120  Microbial metabolism in diverse environments
ffo01130  Biosynthesis of antibiotics
ffo01200  Carbon metabolism
Module
ffo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ffo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FFONT_1207
   00020 Citrate cycle (TCA cycle)
    FFONT_1207
   00620 Pyruvate metabolism
    FFONT_1207
   00640 Propanoate metabolism
    FFONT_1207
   00650 Butanoate metabolism
    FFONT_1207
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    FFONT_1207
   00680 Methane metabolism
    FFONT_1207
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    FFONT_1207
Enzymes [BR:ffo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     FFONT_1207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR POTRA_1
Motif
Other DBs
NCBI-ProteinID: AFH43195
UniProt: I0A2I8
Position
complement(1153864..1154460)
Genome map
AA seq 198 aa AA seqDB search
MYPFQEELLNKDIIEVTWLGRGGQGAVTASELVAMSAIKEGKNAIAIPEFGAERRGVPVR
AYTRVSKELKEIHKTPIVNPDIFVLLDPSLLSKAKNYIDLKDDGVVIANTQLSKDEAIKV
MGIKVKEENFFVIDAKSIVMRILGRPIYNTVMVGAFIAIVPIVKLETVLESVRETFKGKL
GDLNAQVIEEGYKHFLKK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtatccttttcaagaggagcttctaaataaagatataattgaggtgacatggctagga
aggggaggacaaggagcagtcacagcatctgagctagtcgctatgtctgcaataaaggag
gggaaaaatgcgatagcgattccagaattcggcgctgaaaggagaggagttccagttaga
gcttatacgagagtttctaaagagctgaaagaaatacataagactccaattgttaatcca
gacatattcgtccttctggatcccagcttgttatcgaaagctaaaaactatattgatctc
aaagatgatggagttgtgattgcaaacacccaactatcgaaagatgaggccataaaagta
atgggaataaaagttaaggaagagaacttttttgtcattgatgcaaaaagcatagtaatg
aggatactaggaaggcctatatataacacggtaatggtcggggcatttatagcaatagtt
ccgattgtaaagctggaaacagtgctggagtctgtaagagagacttttaagggaaagcta
ggagatctgaatgcgcaagttattgaagaaggttataagcattttttaaaaaaataa

DBGET integrated database retrieval system