KEGG   Fimbriimonas ginsengisoli: FGOP10_02247Help
Entry
FGOP10_02247      CDS       T03038                                 

Definition
diguanylate cyclase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
fgi  Fimbriimonas ginsengisoli
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:fgi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    FGOP10_02247
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    FGOP10_02247
Enzymes [BR:fgi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     FGOP10_02247
Lipid biosynthesis proteins [BR:fgi01004]
 Desaturase
  First
   FGOP10_02247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(3340422..3341402)
Genome map
AA seq 326 aa AA seqDB search
MIQTAVNKPFWQKAVTVFIMVFPCFAMLVAAWTFSRSPHRGELWYGLTIALFLLIGIKVR
MYGISLGFHRGLTHKSYESKPWLRGLFLIMGCMAIQGEPVRWATDHTEHHRYADKDGDPH
SPEHGFWHAHWGWLVEHPFDREINPAFKNDALAMKVSRFTWLWAVVGLAIPAAIGQLVGI
GWWDGFLWGGCAAVFFGNQATYWVNSGAHTFGRRDFQTDDKSTNFWLKGPIGYPISWIVA
WISCGETNHNNHHAIGNSANHGMFKGQLDPSARTLKMLEKLKLVWNVNWTTEEAVIKRQR
ELTMTPEERKAEALRLHRERQEKVPA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgattcaaacagcagttaacaagccgttttggcagaaggccgtcaccgtgttcatcatg
gtgttcccttgctttgcaatgctcgtggcggcatggacgttcagccggtcgccgcatcgc
ggcgagctatggtacgggctgacgatcgccctctttctcctcatcggcatcaaggtgcgg
atgtacggcatttcgctgggctttcaccgcggcctcacccacaagagttacgaatcgaag
ccttggcttcgcggtcttttcctcatcatgggctgcatggcgatccagggcgaaccggtc
cgctgggccaccgaccacacggaacatcaccgctacgcggataaggatggcgacccgcac
agccctgagcatggcttctggcatgctcactggggatggcttgtcgagcatccgttcgac
cgggaaatcaacccggctttcaagaacgatgccttggcgatgaaggtcagccgattcacc
tggctctgggccgtcgtcggccttgccattcccgccgcaatcggacagcttgtcggtatc
ggctggtgggatggtttcctctggggcggctgcgccgccgtcttcttcggcaaccaggcc
acctactgggtgaattccggcgcccacaccttcggtcgacgcgatttccaaaccgacgac
aagagcaccaacttctggctcaagggcccgatcggttatccgatctcctggatcgtcgcc
tggatctcctgcggcgagacgaaccacaacaaccaccacgccatcggcaactccgccaac
cacggcatgttcaagggccagctcgatccctccgcgcgcaccttaaagatgctcgagaag
ctcaagctcgtctggaacgtgaactggactaccgaggaggcagtgatcaaacgccaacgc
gagctcacgatgacccccgaagagcggaaggccgaggcgctgcgcctccaccgcgagcgc
caagaaaaggtccccgcttag

DBGET integrated database retrieval system