KEGG   Fimbriimonas ginsengisoli: FGOP10_03147Help
Entry
FGOP10_03147      CDS       T03038                                 

Definition
2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
fgi  Fimbriimonas ginsengisoli
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fgi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FGOP10_03147
Enzymes [BR:fgi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     FGOP10_03147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
4650797..4652596
Genome map
AA seq 599 aa AA seqDB search
MIVPIRKGVKLGRSLRTLAAIAGAFVIAQTASAGVLLQGFYWDVPSPAAGSGSAPWWWDK
LAGQANSLKLSGFTAVWIPPVLKGAAGGYSVGYDPFDDYDIGSKSQQGTIPTRYGTREQL
ERCCAMLRANSLDIYCDIVDNHRNGDPGNYQFSYLDAYGVANGGRFGKGQWDFHPNVSQD
PNVPVGASEDFNAFGRDLAPINGPSNWIFNGLNSSGDWVTKALDLQGYRLDYVKGISTNW
LSSFLNYGAMSGKFAVGEYFDSNLGSIQYWISTMMGNRASAFDFPLRDQLKGMCNSPGSF
NMANLDHAGLAGVDPAHAVTFVENHDTDRSDAIFQNKALAYAYILTSEGYPSVFYKDYST
DAGCYGMKPTIDNLMWVHEKLASGTTTQRYKNNLVFVYERNGGQHLLVGLNNNTGFGYNL
TCATGFGANRQLHDYTGHAPDVWTDGSGNVSLSLPTATNGMGYVAYAPVGIGGSFTASQL
STTQEYAGATDLDIKPADNTALVQVCRINVAAGKSISGALYFTTTSWTASTNIYLELDNP
SGGIVTTKTYTTGTAQGAALTATASTAGWYTFKIRSNNTPAGNLKPTYWLRATYTAPQT
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtcccaattcggaaaggtgtcaagttaggccgtagcctcagaacgttagccgcc
atcgcgggcgctttcgtcatcgcccaaaccgccagcgcgggggtgcttctacaaggattt
tattgggacgttccgtctcccgccgccggcagtggttcggctccctggtggtgggacaag
cttgccggacaggcgaactctttgaagctgagcggattcactgccgtctggattcccccg
gttctcaagggcgcggcgggcggctactcggtcgggtacgacccgttcgacgattacgac
atcggctccaagagtcagcaagggacgattcccacccgctacggcacccgcgagcagctc
gagcgttgctgcgccatgctccgggcgaactcgctcgacatctattgcgacatcgtcgac
aaccaccggaacggcgatcccggcaactatcagttttcttatctcgatgcctacggcgtc
gccaatggcggacggttcggcaagggccagtgggacttccatccgaatgtaagccaagac
ccgaacgtgccggtcggcgcttcggaagatttcaacgcctttggacgcgacctcgccccg
atcaacggcccctccaattggatctttaacggcctgaatagcagcggcgactgggtgacc
aaggcgctcgacctacaggggtaccggctcgactacgtcaaagggatctccacgaactgg
ctctccagcttcctgaactacggagcgatgtcgggcaagttcgccgtcggcgagtacttc
gactccaacctcggaagcatccagtattggatctccacgatgatgggcaaccgcgcgagc
gcgttcgacttcccgctccgcgatcagctgaaagggatgtgcaactcgcccggctccttc
aacatggcgaacctggaccatgccggccttgccggcgttgaccccgcccacgcggtgacc
ttcgtcgagaatcacgacaccgaccgatcggacgcgatcttccagaacaaggcgctcgcc
tacgcttacatcctcacctccgagggttacccgagtgtgttctataaggactacagcacc
gacgccggctgttacggcatgaagccgacgatcgacaatctgatgtgggtccacgagaag
ctggcgagcggtaccaccactcagcgatataagaacaacctcgtgttcgtgtacgagcgg
aacggcgggcagcacctgctggtcggtctgaacaacaacaccggctttggctataacctg
acttgcgccaccggtttcggagcgaaccggcagctgcacgactacaccggacacgccccc
gacgtgtggacggacggcagcggcaacgtgtcgctcagcctcccgaccgccacgaatgga
atgggctacgtcgcgtacgctcccgtcggcatcggaggctcgttcaccgcgtctcagctt
tcgacgacccaagagtacgccggagcaaccgacctcgatatcaagccggccgacaacacc
gcgctcgtccaggtctgccgcatcaacgtcgccgccggcaaatcgatctccggcgccctc
tacttcaccaccacgagctggaccgcctccacgaacatctacctagagctcgacaacccg
tccggcggaatcgtgacgacaaagacgtacacgaccggaaccgcccagggagccgccctg
acggcaaccgcgtccaccgccggctggtacacgttcaaaatccgctccaacaacacccca
gccggaaacctaaagcccacatactggctccgcgccacctacaccgccccccaaacctag

DBGET integrated database retrieval system