KEGG   Fusarium graminearum: FG00068.1Help
Entry
FG00068.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
fgr  Fusarium graminearum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:fgr00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:fgr00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:fgr00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:fgr00603]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 725 aa AA seqDB search
MTLTTSPKVDPIVVDGTSFALNGKNVSYRFHVDSATGDLLLDHFGSRVTENPIAQIQSNG
GGWSTQAHLRREFPDLGRGDFRTPAVHIKHAKGFTVCDFKYKSYTITKGKPALEKLPCTF
GSDDGVSTLVIHLCDEQSSVGADLSYSIFPNSDAIVRNVRVINNSDDVIVVEKLASFSVD
FPHDEYDMLHLRGEWTRECSRTRRKVEYGTQGFGSTTGYSSHYHNPFLSLVNPTTTESHG
DAWGFSLVYTGSFNVEVEKSHQGLTRAVIGINPCQLSWPLRSGETLQSPECVSIFSNLGI
GEMSRKFHRLYRRNLIRSKFVNETRPVLLNSWEGLYFNFDQKTIYKLAQESAKLGAKLFV
LDDGWFGDKHPRINDHAGLGDWVVNPKRFPDGLGPLVESVNKLKAAGSEENLQFGIWVEP
EMVNQKSELYEQHPEWVLSAGTYTRSETRQQLVLNVALPEVQEYIIDSVAKILDSAPITY
VKWDNNRAMHESPTPGNQHAYMLGIYHVFDVLTTRFPHVLWEGCASGGGRFDPGILQYFP
QVWTSDNMDAYDRVHIQFGTSLVYPPSTMGAHVCSSPNDVTGRSIPMRFRAHVAMMGGSF
GFELDPDHTPEEDKKQIPELIALAERINPIIISGDMWRLVLPEKSNFPAAIFVSEDGSEA
VLFAFQLMSTTVSNFPLLRLAGLDPNARYKLDGGDIYSGATLMNGGIQYRFGTDYDSKVV
LLERV
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgacccttacaacaagccccaaagtcgacccaatcgtggtcgatgggacatcattcgcc
ctcaacggcaagaatgtctcctaccgcttccatgtcgattcagcgaccggggaccttctt
ctggaccatttcggttcccgcgtgacagaaaaccccattgcccagatccaatccaacggc
ggaggctggtccacgcaggcccatcttcgccgggagtttccagacctcggcagaggagac
tttcgcacccctgctgtgcacatcaagcacgcaaagggcttcacggtctgtgatttcaag
tacaagtcatacacaattactaaaggcaagcctgctttggagaaattgccttgtacgttt
ggctcagacgatggtgtttcaacgcttgtgattcatctatgcgatgagcagagttctgtt
ggagctgatctgtcttattcgatctttcccaactctgatgctattgtcagaaatgtcaga
gttatcaacaatagtgatgatgtcattgttgttgagaaactggctagcttcagcgttgat
ttcccccacgacgagtatgatatgttgcacctccggggagaatggacaagggaatgcagc
aggactcgccgaaaggtcgagtatggaacgcaaggatttggaagcacgactggttactcg
tctcattaccataacccattcttgtctttggtcaacccaaccacaaccgagtctcacggc
gacgcttggggcttctctctcgtctataccggctctttcaacgtcgaagttgaaaagagt
caccaaggattaacccgagcagtcattggcataaacccatgccaactctcctggccattg
cgttccggcgagactctccaatccccagaatgtgtttccatcttttccaatctcggcatc
ggcgaaatgtcacgaaagttccaccgtctctatcgtcgcaacctcatcagaagcaaattt
gttaacgaaactcgcccagtcctgctcaacagctgggaaggtctctacttcaactttgac
caaaagacgatttacaagctcgctcaagagtctgctaaattaggcgccaagctctttgtg
cttgatgatgggtggtttggagataagcaccctcgtatcaacgaccacgctggattgggc
gactgggtcgtaaatcccaagagattccccgatggcttgggtcctcttgttgagagtgtc
aacaagctcaaggctgccgggtcggaggagaaccttcaatttggcatttgggtcgagcct
gagatggtcaaccagaaatccgagctttatgaacagcaccccgagtgggttttgagcgca
ggtacctacacacgcagcgagactcgtcaacagcttgtcctcaacgtagcacttcccgag
gtgcaggagtacatcatcgattcagtggccaagatcctggattcagcacccatcacctac
gtcaaatgggacaataaccgagctatgcatgaaagtccaacacctggtaaccaacacgct
tacatgcttggtatctaccatgtctttgacgtgctgacgactcgctttccccatgttctc
tgggaaggttgtgcttccggcggcggtcgattcgatcctggcatcctacaatatttccca
caggtctggacatccgacaatatggatgcctacgatcgcgttcacatccagtttggtaca
tcgttggtgtacccaccgtcaaccatgggagcgcatgtgtgttcttccccgaacgacgta
acaggacgttccatcccaatgcgcttccgagctcatgtcgccatgatgggaggctccttt
gggtttgaacttgacccggaccacacacccgaggaagacaagaagcagatcccagaactc
attgcgctggctgagaggatcaaccctatcatcatcagtggtgacatgtggcgtcttgtg
ctgcctgaaaagtccaacttccctgcagcaatctttgtttcggaagatggaagcgaagct
gtcctctttgccttccaattgatgtcaactaccgtttccaacttccctctgcttcgcctt
gcaggccttgacccgaatgcgagatacaagcttgatggtggtgatatttattctggagca
acattgatgaacggtggtattcagtatcgattcggtactgactatgatagcaaggttgtt
cttttggagcgtgtttaa

DBGET integrated database retrieval system