KEGG   Fusarium graminearum: FG00176.1Help
Entry
FG00176.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
fgr  Fusarium graminearum
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:fgr01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:fgr00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 599 aa AA seqDB search
MMRRLSTRAPQRLISAASKSRSCAPLLAIRAISSTSVAKMSSLSTHATQPADAFQLLPES
QKPGEAEDRLYEATVHEIEAWWASPRFAGIKRPYSAEDVATKRGTQKVQYPSSVMAQKLF
NLIREREAKGEPIHTMGAIDPVQMTQQAPHQEVLYISGWACSSLLTSTNEVSPDFGDYPY
NTVPNQVQRLAKAQNMHDRKQWDLRRKMTAEERTKTPYTDYLRPIIADGDTGHGGLSAVL
KLAKLFAENGAAAVHFEDQLHGGKKCGHLAGKVLVPIGEHINRLVATRFQWDVMGCENLV
IARTDSESGKLLSSAIDVRDHEFILGVADPSIEPLAETIQAMEAKGAAGAEIDAFEAQWV
KNTKLITFDEAAVAHMKKEGVEQSKIDEYLAETDKDHDMGISRRRGLANKYTKEPVYFNW
DVPRTREGFYHYRAGMQAATKRALAFGPYADLLWVETGDPNVQVASKLGRAVREVYPGKG
LVYNLSPSFNWMAHGFTDETLKSFIWDIAREGFVLQLISLAGLHSNATITTELSREFKKD
GMKAYVDIVQRREKDLKCDVLTHQKWSGASYIDGILGAIQSGSSSSKSMGEGNTEGQFH
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgcagactatccacgagagctccccagcgcttaatctcagctgcttccaagtcc
cgcagctgcgcaccccttctcgccatccgagccatatcctccacatccgtcgcaaagatg
tcgtccctcagcacccacgcgacacagcccgccgacgctttccagctgctaccagagtcg
caaaagcctggcgaggccgaagatcgactttacgaagctaccgtccatgagattgaggct
tggtgggcttcgcccaggtttgccggcatcaagcgtccgtacagcgctgaggatgttgct
accaagcgcggaacgcaaaaggttcaatatcctagctctgtcatggctcagaagctcttc
aatctaatccgtgagcgtgaagccaagggtgaacccatccatacgatgggcgcaattgac
cccgttcaaatgacccagcaagctcctcaccaagaggtcctctacatctcgggctgggca
tgctcctccctcctcacctctaccaacgaggtctcccccgactttggcgactacccatac
aacaccgttcccaaccaggtccagcgcctggccaaggcgcagaacatgcacgaccgaaag
caatgggatcttcgtcgcaagatgaccgccgaggagcgcacaaagacaccatataccgac
tacctccgacccatcatcgctgatggtgataccggccacggtggtctgtcagctgttctt
aagctcgctaagctatttgctgagaacggtgctgctgctgttcactttgaggaccagctt
cacggtggaaagaagtgcggtcatctcgcaggcaaggtcctcgttcctatcggagagcac
atcaaccgccttgtcgccacgcgcttccagtgggatgtcatgggctgcgagaacctcgtc
attgctcgaacagactctgaatctggcaagcttctgtcatctgccattgatgtacgcgat
cacgagtttattctcggtgttgcagacccctcaattgagcctttggccgagaccatccag
gctatggaagccaagggtgctgcaggcgctgaaattgacgctttcgaggcccaatgggtc
aagaacaccaagctcatcacttttgacgaagctgctgtcgcacacatgaagaaggagggc
gttgagcaatccaagattgacgaataccttgccgagacagacaaagaccacgacatgggc
atttcacgccgtcgtggtctcgcaaacaaatacaccaaggagcctgtctactttaactgg
gacgtcccccgcacccgagaaggcttctaccactaccgcgccggcatgcaagcagctacc
aagcgcgccctcgcattcggcccctacgcagatctcctctgggtcgagacaggcgatccc
aacgtccaagtagcatccaagctaggccgcgccgtccgcgaggtttaccccggcaagggt
ctcgtatacaacctttctccatcattcaactggatggcccacggtttcacggacgagacc
ctcaagtcattcatctgggatattgcgcgcgagggttttgttctgcagctcatttcgctc
gcgggtctgcactccaacgctaccatcacaacagagctgtcgcgcgagttcaagaaagat
ggtatgaaggcgtatgttgatattgtgcagcgtcgcgagaaggacttgaagtgtgatgtt
ttgacgcatcaaaagtggagtggtgccagttacattgatggcatcctgggtgctatccag
agtggaagttcgagcagcaagagtatgggcgagggtaataccgagggacagttccactag

DBGET integrated database retrieval system