KEGG   Fusarium graminearum: FG00244.1Help
Entry
FG00244.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
fgr  Fusarium graminearum
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    FG00244.1
Enzymes [BR:fgr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     FG00244.1
Exosome [BR:fgr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   FG00244.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 570 aa AA seqDB search
MPSFDENKAYVEQEETFFDDGREIELLHYIYGRSDIDELRGSPERVLQAIDEFGRTKKYL
MNVGEDKGKIVTDLIAEVKPKVMVQSIVELGGYVGYSTLLFANAVRKAGGTNYYSLERNP
EFAAVITSLLDLSGLSSMARVIVGPSDAGLARLHKNGTVKKIDLMFLDHYKPAYTSDLKL
CERLGLVGPGSVLAADNVIKPGNPPYLAYVRSSVAEKRAARGQGDDKDGFADRTAKQYLK
REGEEKLNEEEGDPNLVYESKLVHSFEPTGVPFKLPLNTKTQRRYLPLTMPLGVPAFQQI
KSHARLAQSVERETLTMFVICDGGVLGTRAKNSDDVQLFPLDDPAIKCERFIVRKTLNAT
SSSNRCQIFSRSMPIMVGVRASSREIIMNEYHPIMVTISFTSISQSLQATQESSLLNGII
LNVRDWQCRATGMSSYRLQRCVGQVRPDSMTAPVKVHSDKIWHGNIKIPGREVSGPIHFK
GIIIRHVRAEKPIDDDDDYHYLELPLKGRLSWYFTRFWMVVEQFDSSEVHDEVGEALVLG
KGSNTFSESEVKTFDVRVSKANYRRGLVLV
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgccttcctttgacgagaacaaagcttatgttgagcaagaagagacctttttcgatgat
ggaagagaaattgagcttttgcattatatctacggtcggtcggatatcgatgagttgcgt
ggttcgccggagcgcgtgctccaggctattgatgagtttggtcgcaccaagaagtatctc
atgaacgttggtgaggacaagggcaagattgtgacagatcttatcgctgaagtgaagccc
aaagtcatggtacagtcaattgtcgaactcggcggctatgtaggctactcaactctcctc
ttcgccaacgccgttcgcaaagcaggcggcacaaactactactccctcgagcgcaacccc
gaattcgcagcagtaataacatccctcctcgatttgtcagggttatcatcaatggcccgc
gtcatcgtcggccccagcgacgccggtctagcacgtctacacaagaacggcaccgtcaaa
aagatcgacctcatgttcctcgaccactacaagcccgcctacacaagcgatctcaagctc
tgcgagcgtcttggccttgtcggaccgggtagtgtgcttgcagcggataatgtcatcaag
cctggaaacccaccttatcttgcgtacgtgaggagcagtgttgctgagaagagagctgcg
aggggacagggcgatgataaggatggatttgcggataggacggcgaaacagtacctcaag
agggaaggagaagagaaactcaatgaggaagagggtgatcccaatctggtgtacgagagt
aaattggttcacagctttgaaccaactggtgttcctttcaagctgcccctcaacaccaag
acacaacgtcgctatcttcccctcacaatgcctctgggcgtccccgcctttcaacaaatc
aagagccacgcccggttagctcaatcggtagagcgtgagactcttacgatgtttgtgata
tgtgatggtggtgtgcttgggacccgcgcgaagaacagcgatgatgtccaacttttccca
ttagatgacccagcaattaaatgtgagcgatttattgttagaaagacattaaacgctacc
tcgtctagcaatcgctgtcaaattttctcgcgctcaatgccaatcatggttggggttcgc
gcaagttcccgcgagatcatcatgaacgagtatcacccaatcatggtgaccatctccttc
acatcaatttctcagtcactccaagcaactcaagagtcatcgctacttaatggtattatt
ttgaacgtcagggactggcaatgtcgggctactggcatgagttcctaccgtcttcaacgg
tgcgttgggcaggttcggcctgatagtatgactgctccggtcaaggttcactcagacaag
atctggcacggtaacatcaaaattccgggacgagaagtctcgggccctatacactttaag
ggcattataatcaggcatgttcgcgcagagaagccaatcgacgacgacgatgactatcat
tatctcgagctgccgctgaaagggcgtcttagttggtactttacacgcttttggatggtt
gtggaacaattcgacagtagcgaggttcatgatgaggttggtgaagctctggttcttgga
aaggggagtaacaccttcagtgaatcagaggtcaagacttttgatgttcgggtaagcaag
gccaactatcgacgtggtctagtattagtctaa

DBGET integrated database retrieval system