KEGG   Fusarium graminearum: FG00244.1Help
Entry
FG00244.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
fgr  Fusarium graminearum
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:fgr00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 570 aa AA seqDB search
MPSFDENKAYVEQEETFFDDGREIELLHYIYGRSDIDELRGSPERVLQAIDEFGRTKKYL
MNVGEDKGKIVTDLIAEVKPKVMVQSIVELGGYVGYSTLLFANAVRKAGGTNYYSLERNP
EFAAVITSLLDLSGLSSMARVIVGPSDAGLARLHKNGTVKKIDLMFLDHYKPAYTSDLKL
CERLGLVGPGSVLAADNVIKPGNPPYLAYVRSSVAEKRAARGQGDDKDGFADRTAKQYLK
REGEEKLNEEEGDPNLVYESKLVHSFEPTGVPFKLPLNTKTQRRYLPLTMPLGVPAFQQI
KSHARLAQSVERETLTMFVICDGGVLGTRAKNSDDVQLFPLDDPAIKCERFIVRKTLNAT
SSSNRCQIFSRSMPIMVGVRASSREIIMNEYHPIMVTISFTSISQSLQATQESSLLNGII
LNVRDWQCRATGMSSYRLQRCVGQVRPDSMTAPVKVHSDKIWHGNIKIPGREVSGPIHFK
GIIIRHVRAEKPIDDDDDYHYLELPLKGRLSWYFTRFWMVVEQFDSSEVHDEVGEALVLG
KGSNTFSESEVKTFDVRVSKANYRRGLVLV
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgccttcctttgacgagaacaaagcttatgttgagcaagaagagacctttttcgatgat
ggaagagaaattgagcttttgcattatatctacggtcggtcggatatcgatgagttgcgt
ggttcgccggagcgcgtgctccaggctattgatgagtttggtcgcaccaagaagtatctc
atgaacgttggtgaggacaagggcaagattgtgacagatcttatcgctgaagtgaagccc
aaagtcatggtacagtcaattgtcgaactcggcggctatgtaggctactcaactctcctc
ttcgccaacgccgttcgcaaagcaggcggcacaaactactactccctcgagcgcaacccc
gaattcgcagcagtaataacatccctcctcgatttgtcagggttatcatcaatggcccgc
gtcatcgtcggccccagcgacgccggtctagcacgtctacacaagaacggcaccgtcaaa
aagatcgacctcatgttcctcgaccactacaagcccgcctacacaagcgatctcaagctc
tgcgagcgtcttggccttgtcggaccgggtagtgtgcttgcagcggataatgtcatcaag
cctggaaacccaccttatcttgcgtacgtgaggagcagtgttgctgagaagagagctgcg
aggggacagggcgatgataaggatggatttgcggataggacggcgaaacagtacctcaag
agggaaggagaagagaaactcaatgaggaagagggtgatcccaatctggtgtacgagagt
aaattggttcacagctttgaaccaactggtgttcctttcaagctgcccctcaacaccaag
acacaacgtcgctatcttcccctcacaatgcctctgggcgtccccgcctttcaacaaatc
aagagccacgcccggttagctcaatcggtagagcgtgagactcttacgatgtttgtgata
tgtgatggtggtgtgcttgggacccgcgcgaagaacagcgatgatgtccaacttttccca
ttagatgacccagcaattaaatgtgagcgatttattgttagaaagacattaaacgctacc
tcgtctagcaatcgctgtcaaattttctcgcgctcaatgccaatcatggttggggttcgc
gcaagttcccgcgagatcatcatgaacgagtatcacccaatcatggtgaccatctccttc
acatcaatttctcagtcactccaagcaactcaagagtcatcgctacttaatggtattatt
ttgaacgtcagggactggcaatgtcgggctactggcatgagttcctaccgtcttcaacgg
tgcgttgggcaggttcggcctgatagtatgactgctccggtcaaggttcactcagacaag
atctggcacggtaacatcaaaattccgggacgagaagtctcgggccctatacactttaag
ggcattataatcaggcatgttcgcgcagagaagccaatcgacgacgacgatgactatcat
tatctcgagctgccgctgaaagggcgtcttagttggtactttacacgcttttggatggtt
gtggaacaattcgacagtagcgaggttcatgatgaggttggtgaagctctggttcttgga
aaggggagtaacaccttcagtgaatcagaggtcaagacttttgatgttcgggtaagcaag
gccaactatcgacgtggtctagtattagtctaa

DBGET integrated database retrieval system