KEGG   Fusarium graminearum: FG00280.1Help
Entry
FG00280.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
fgr  Fusarium graminearum
Brite
Enzymes [BR:fgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     FG00280.1
Transcription machinery [BR:fgr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     FG00280.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 443 aa AA seqDB search
MMLHPIISNFSLNNIKSQQPGLSPHQSCQTKVSPTHYATATRVKLLTYGQTDGKRKAEEE
PSSPTPSKRIKQDDSAEPPEKKPDIKRIPFPEKPAVIEERNGEIEFRVVNNDNEREALII
LTGLKCIFQKQLPKMPKDYIARLVYDRTHLSIAIVKKPLEVVGGITYRPFKGRRFAEIVF
CAISSDQQVKGYGAHLMSHLKDYVKATSDVMHFLTYADNYAIGYFKKQGFTKEITLDKKV
WMGYIKDYEGGTIMQCSMLPRIRYLEMGRMLLKQKECVQAKIRAYSKSHNIHAPPKEWKN
GITEINPLDIPAIRASGWSPDMDELARQPRHGPNYNQLLHLLNDLQNHNSAWPFLVPVNR
DDVADYYDVIKEPMDLSTMESKLEADQYLTPEDFIRDAKLVFDNCRKYNNESTPYAKSAN
KLEKFMWQQIKAIPEWSHLEPEK
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgatgctgcatcccatcatatccaacttctccttgaataatatcaagtcccaacaacct
gggttgagcccgcaccaatcatgtcagacgaaagtaagtcctacacactatgcgaccgcg
acaagagtcaaattactaacatacggccaaacagacggcaagcgcaaagccgaagaggag
ccttcatctcctacaccatcgaagcgcattaagcaagatgattccgccgagccaccagaa
aagaaaccagatattaaacgaatcccattccctgaaaagcctgctgttatcgaagagcgc
aatggtgaaatcgagtttcgagtcgtcaacaacgataatgaacgcgaagcactcatcatc
ctgaccggcctcaaatgtatctttcaaaaacaactcccgaaaatgccaaaggactatatc
gcgcgacttgtctacgaccgaactcacttgtccattgccatcgtcaaaaagcccctcgaa
gttgttgggggaatcacatatcgcccgtttaaaggacgccgtttcgccgagattgtcttc
tgtgccattagctctgaccagcaagtcaagggatacggtgcccatctcatgtcccacttg
aaggactatgtcaaggcgacaagcgacgtgatgcatttcttgacgtatgccgataactat
gcgattggctacttcaagaagcagggcttcaccaaagagattacccttgacaagaaggtc
tggatgggttacatcaaggattacgaaggtggtaccattatgcagtgctctatgttgcca
cggattcgctatctcgagatgggtcgcatgctccttaagcagaaagaatgtgtccaagca
aagatccgggcgtactccaaatcccacaacatccatgctcctccgaaggaatggaagaac
ggaattacagaaatcaaccctcttgacattccagctattcgagcatcaggatggtcacct
gatatggacgaactggcccgccaaccccgccacgggcccaactacaaccagcttcttcat
ctgttgaacgaccttcagaaccacaactcagcctggccattcttggtgcccgtcaaccgt
gatgacgtggctgattattacgatgtgatcaaggaacccatggatttgagtactatggag
agcaagctcgaggcagaccagtaccttacgcctgaggattttatcagagatgccaaattg
gtgttcgacaactgccgaaagtacaataacgagagtacaccgtatgcaaagtcggccaac
aagcttgaaaagtttatgtggcagcagatcaaagccattcccgagtggtctcacctggag
cctgagaaatag

DBGET integrated database retrieval system