KEGG   Fusarium graminearum: FG00286.1Help
Entry
FG00286.1         CDS       T01038                                 

Definition
similar to cap binding protein
Orthology
K03259  
translation initiation factor 4E
Organism
fgr  Fusarium graminearum
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    FG00286.1
Translation factors [BR:fgr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    FG00286.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 190 aa AA seqDB search
MDEQGDNWNDLLKEVITFDSVEEFWGVYNNVAPVSELSLKSDYHLFKEGVRPEWEDPQNK
HGGKWSYQYKDKRNIDIDRLWLQVMMGAIGETLENEDDGEVMGVVVNVRKAFFRIGVWTR
TIGKSIPGRGEGDVAGGKGRSGEKGKEILLSIGRRFKEVLELPASEQVEFSGHTDSAHSG
STRAKAKHVV
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggacgagcagggcgacaactggaacgatctcctcaaggaggttatcacgttcgactct
gttgaagagttttggggcgtctataacaacgtcgcacccgtttccgaactctccctcaag
tccgactaccacctttttaaggaaggtgtccgccctgagtgggaggatccccagaacaag
cacggtggcaagtggtcttaccagtataaggacaagcgcaacatcgatatcgatcgtctg
tggctccaggttatgatgggcgctatcggcgagactcttgagaacgaagatgatggcgaa
gttatgggagttgttgtcaacgtccgtaaggcattcttccgtatcggcgtctggactcgc
accataggaaagagcattccgggccgaggtgaaggtgatgttgccggcggtaagggccgt
agcggagagaagggtaaggagattctcctgtctatcggacgccgcttcaaggaggtcctc
gagctgcccgcttccgagcaagttgagttctccggtcacaccgacagtgctcactctggc
agcacgagagccaaggccaagcacgtcgtttaa

DBGET integrated database retrieval system