KEGG   Fusarium graminearum: FG00330.1Help
Entry
FG00330.1         CDS       T01038                                 

Definition
similar to acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
fgr  Fusarium graminearum
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FG00330.1
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FG00330.1
   00620 Pyruvate metabolism
    FG00330.1
   00640 Propanoate metabolism
    FG00330.1
  Energy metabolism
   00680 Methane metabolism
    FG00330.1
Enzymes [BR:fgr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     FG00330.1
Lipid biosynthesis proteins [BR:fgr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   FG00330.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 683 aa AA seqDB search
MASPAPAPAPAAAETVSLKSEETQAPAKETKGPVVAEAHLVDTYQHPHRPHLANLEEYKR
LYKESITQPEKFWAERARELISWDNDFKTTQSGSLLNADVSYFNEGRLNASYNCVDRHAF
KDPDRVAIIYEADEPSEGRNVTYGELLREVSRTAWVLKQMGVRKGDTVAIYLPMIPEAII
ALMACVRIGAVHSVIFAGFSSDSLRDRVVDAGSKVVITTDEGKRGGKLIGTKKIVDDALK
QCPAVENVLVYKRTGSEIPWTSGRDFWWHEEVEKWPNYFPPEPVASEDPLFLLYTSGSTG
KPKGVLHTTAGYLLGAAMTGKYVFDIHEGDRYFCGGDVGWITGHTYVVYAPLMLGVSTVV
FEGTPAYPNFSRYWDIIEKHDVTQFYVAPTALRLLKRAGDEHVRGKFAHLRVLGSVGEPI
AAEIWKWYFEVIGKEECHIVDTYWQTESGSHVITPLAGITPTKPGSCSLPFFGVEPALID
PVSGEEIHGNDVEGVLTFKQSWPSMARTVWGAHNRYKETYLDVYKGYYFTGDGAARDHEG
FYWIRGRVDDVVNVSGHRLSTAEIEAALLEHHAVADAAVVGIADELTGQAVNAFVDLEKN
VEATDALRKELIVQVRKSIGPFAAPKAVYIVPDMPKTRSGKIMRRVLRKIVAGEEDQLGD
TTTLSDPSVVDKIIKAVHDAKRK
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggcctctcccgctcccgctcccgcccctgcagccgctgagactgtctcattgaagagt
gaagaaacacaagctcctgccaaagagactaaaggccctgtagttgctgaagcacatctc
gttgatacataccaacacccccaccggccccaccttgccaatctcgaggagtataagcga
ctctacaaggaatccatcacacaacccgaaaagttctgggctgaacgcgcacgtgaactc
atctcatgggacaacgacttcaagaccacccaaagtggttcacttctgaatgctgatgtc
tcatacttcaacgaaggccgcctgaatgcctcatacaactgtgttgaccgtcacgctttc
aaggatcccgatcgtgttgccatcatctacgaggctgatgagcccagtgagggacgcaat
gttacgtatggcgagctactgcgggaagtctctcgaactgcttgggttctcaagcagatg
ggtgtccgcaagggtgatactgtcgctatctacctacccatgattcctgaagccatcatc
gcacttatggcctgtgttcgtattggcgcagttcattcagttatctttgctggtttctcc
tccgactccctgcgcgatcgtgttgtcgatgctggctccaaggtcgtcatcacaactgat
gaaggcaagcgaggcggcaagttgattggcaccaagaagattgtcgacgatgctctcaag
cagtgccctgctgttgagaatgttcttgtctataagcgcacaggctcagagatcccctgg
accagcggccgtgacttctggtggcatgaggaggttgagaagtggcccaactacttccct
cctgagcctgtcgcttccgaagaccccttattccttctctacacttctggttccactggc
aagcccaagggtgttttgcacacgacagccggatatctccttggtgccgccatgactggc
aagtatgtctttgatatccatgagggcgatagatacttctgcggcggtgacgtcggctgg
atcaccggtcatacttatgtcgtttatgctcccctgatgctcggtgtatccactgtcgtc
tttgagggtacacccgcctaccctaacttctcgcgatactgggacattattgagaagcac
gacgttacccagttttacgtcgcccccaccgctctgagactgttgaagcgtgctggcgat
gagcatgtccgaggaaagttcgctcatcttcgggtactaggctctgtcggcgagcctatc
gctgccgagatctggaagtggtactttgaggttattggaaaggaggagtgccacatcgtc
gacacatactggcaaaccgagtctggctcccatgttatcacccccctagctggaattact
ccaactaagcccggcagttgctcgctgcctttctttggtgttgagcctgcccttatcgat
ccagtttccggtgaagagattcatggaaacgatgtcgagggcgttctgacatttaagcaa
tcttggcccagcatggctcgtactgtctggggagcccataaccggtataaggagacttac
cttgacgtctacaagggctactactttactggagatggtgctgcccgagaccacgagggt
ttctactggattcgaggtcgtgttgatgacgttgtcaacgtcagtggtcatcgtctatcg
actgccgaaatcgaggcagcgctattggaacaccatgccgttgctgacgcagcagttgtc
ggtatcgctgatgagcttaccggccaggctgtcaacgcatttgttgatcttgagaagaat
gttgaagcaaccgatgctctacgcaaggaactgattgttcaagtacgcaagagcattgga
ccttttgcagcacccaaggccgtatacattgtgccggatatgcctaagacgcgaagcggc
aagattatgcgacgagtgttgagaaagattgttgctggagaagaagaccagcttggagat
accactactctatcggatccttctgttgtggacaagatcatcaaggctgttcatgatgcc
aagcgcaagtga

DBGET integrated database retrieval system