KEGG   Fusarium graminearum: FG00380.1Help
Entry
FG00380.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K11874  
ubiquitin carboxyl-terminal hydrolase 16 [EC:3.1.2.15]
Organism
fgr  Fusarium graminearum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 623 aa AA seqDB search
MHDKNTSVVSYAAGASLAAAALIYVFAPNFSIDHDATSSKKKTIVGLRNQANDCFINSVL
QALAGLVELRVYLIRETHRRHIEDPAVYASLVQPEGREIAQWKLQGLQEGLVTQGLKEML
DALNERPIYKKSISPFPFVKVLEAAFKQRISRQQQDAQEFLQIVAERLKDEYHCGQRARL
HVRRRGLFPTNSAADTESTTEDQVNGKDSDESSQEQQPHTNGDNNSAIEPSEDTEIPQIN
GQLPLENEEGFPMEGKYESHLECLTCRYKTKPREETFCTITLAVPQVSGTTLNACFDGIF
KTEHIEDFKCEMCRLLQTKAGLEAEMAKSTSESFKAQAQESIDKLQHTIDTDPENPPEDL
ELGDNRYAPKRKIAKTTRMSIFPKILAIHLSRSIYDVGQMTQKNSAKVVFPEQLPLGGLM
DQKKYKLLGLVTHRGGHNSGHYEAFRRQNVVPPFSNSNTFQPSEAFSKTPTPMGTPVLSG
GPTHSPAISTPDLLSGSSGNSSTPSLDSLPPPPRSVPADLRGSASLPAIGKQKDPETSSL
RSVAASTKSAISKLTSPKQTNSSSSTPKLVPSNVSKRSKKRKATSDKWWRVNDEKVKEAK
TSEVLGMQREVYLLFYELDKEDA
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgcacgacaagaatacttcagttgtttcatacgccgccggcgcctctcttgctgccgcc
gcactcatctatgtgtttgcgccaaatttttccatcgaccacgatgctactagttccaag
aaaaagaccattgtcggcttaagaaaccaggccaatgactgcttcatcaattcggttctg
caagctcttgctggcctggtagaactgcgggtgtatctgattcgcgagacacatcgtcgc
catatcgaagaccctgccgtatatgctagtctcgtccaaccagaaggcagagagatcgcg
caatggaagcttcagggtctacaagagggacttgtcacacaaggactgaaagaaatgctg
gatgcgcttaatgagcgccccatctacaagaagtccatatcgccattcccatttgtcaag
gttttggaggcggcctttaagcagcggatcagtcgtcaacagcaggacgcgcaagaattt
cttcaaatcgtcgctgagcgactcaaggacgagtaccattgcggccaacgagctaggctc
catgttagaaggcgtggtttgttccctaccaacagcgctgccgataccgaaagcacaact
gaagatcaagtcaatggcaaggacagcgatgaatcttcacaagagcaacagcctcatacg
aatggcgacaacaactctgccatcgaaccatccgaggataccgagataccgcagatcaac
ggccaactacccttggaaaacgaggaaggcttcccaatggagggaaaatacgagtcgcat
ctcgagtgcctgacatgccgttataagaccaagcctcgtgaggaaacattttgcactatt
acgctggctgtccctcaagtatcgggcacgacgctgaatgcatgcttcgacggcatcttc
aaaactgagcatatcgaggacttcaagtgcgaaatgtgtcgactgctacaaaccaaggcg
ggcctggaagctgaaatggccaagtcgacctcggagagtttcaaggcgcaagctcaggag
agcatcgacaagctccagcatacgatagacacagatcctgagaacccgccggaagatctc
gagcttggggacaaccgctatgcacccaagcgcaagatcgcaaagacgactcgcatgtcc
atatttccaaagattctggctattcacctgtctcgctctatctacgacgtgggacaaatg
acacaaaagaactctgccaaggtagtatttcctgagcaattacctcttggtggcttgatg
gaccaaaaaaaatacaagttgctcggcctagtaacccaccgcggtggacataacagtggc
cactacgaagcgttccgacgacaaaatgttgtcccgcccttctccaactcgaataccttt
cagccttcagaagcattcagcaagacaccaacacctatgggaacacccgtgctcagtggc
ggaccgacacatagcccggccatttccacccccgacctcttgtcaggctcgtctggtaat
tcttcaacgccttctctggattcattgcctcccccacctaggagcgttccggcagattta
cgtggttcggcgagcttgccagcaattggcaagcaaaaggatcctgaaaccagcagcctc
cgctccgtggcagcttctactaaatctgccatctctaagctcacatctcccaagcaaacc
aacagcagctcgtcgacacccaagcttgttccatcgaacgtctcgaagcgatcgaaaaag
cgcaaggcaacgtcagacaaatggtggcgcgtcaacgatgaaaaggtcaaagaggccaag
acgagcgaagtcctgggcatgcagagagaagtctatctactattttatgagctcgataag
gaggacgcttag

DBGET integrated database retrieval system