KEGG   Fusarium graminearum: FG00499.1Help
Entry
FG00499.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K12666  
oligosaccharyltransferase complex subunit alpha (ribophorin I)
Organism
fgr  Fusarium graminearum
Pathway
N-Glycan biosynthesis
Various types of N-glycan biosynthesis
Metabolic pathways
Protein processing in endoplasmic reticulum
Module
N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    FG00499.1
   00513 Various types of N-glycan biosynthesis
    FG00499.1
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    FG00499.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 493 aa AA seqDB search
MKPFAITTALFSLVSAALAGASTESKTSKIILPADFKPPQVFQNANLVHVISLEKNYVKE
QINVLVENVAKEPQTEYYVPFTTEQLPRVGGFEVKDRKDANAGPFVVEPVEYDANSDVQY
YRIQLPTPLKPGAQQTLGITYYYLKAYTPSPAVISQRARQFLAYDFSVYAPSAYTTKKQK
TEIKTGTSNIPDYTKLPGSGDVKEYPVKQGSKLIYGPFEEKPAGAVSPARVRFEFQKPVT
HVKELDRDIEVSHWGGNIAFEEHYDLHYRGANLTGSFSRGDFTKDLIQGNRPSYALSDMR
VPLQVGSVDAYYVDVIGNISTSRFRSNKREALLELKLRYPLFGGWKAPFTIGWNSDASNF
LRKTATGGYVLRVPFIEGPKQLEGVEYEQVNINVLLPEGAVNVKYYANVPESSIMSTSID
LTRTYLDTVGRTHINIKARNLVDEFRDRHLIISYDAPLSSALRKPLIVFASAMAVFVTTW
ALGQLQVEFKQKK
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgttcgccattactacggcgctctttagcttggtatccgccgcactcgctggc
gcaagcactgagtccaagacatcaaagatcatccttcctgccgacttcaaacctccccag
gttttccagaacgccaatttggtacacgtcatctccctcgagaagaattacgtcaaagaa
cagattaacgtccttgttgagaacgtcgcgaaggagccacagacagagtactatgtgcca
ttcaccactgaacagctgcctcgtgtaggaggtttcgaggtcaaggatcgaaaggacgcg
aacgcagggccgtttgtggtcgagcccgtcgaatacgacgccaacagtgatgttcaatac
taccgtattcaattacctacgccactcaagcctggtgctcaacagacgctcggtatcacc
tactactacctcaaggcctataccccttcccctgcagtcatttcgcagagggctaggcaa
ttccttgcctacgacttctccgtttacgcaccatccgcctacaccacgaagaagcagaag
accgaaatcaagactggtacctccaacattcccgattacacaaagcttcctggaagcggc
gacgtcaaggagtaccccgtcaagcagggctccaagcttatctatggaccttttgaagag
aagcccgccggtgctgtctcccccgcgcgtgttcgtttcgagtttcaaaagcctgtgacc
cacgtcaaggagctggaccgcgatatcgaggtcagccactggggcggcaacattgccttt
gaggaacactacgatctgcactaccgcggtgctaacctgactggctcctttagccgagga
gacttcacaaaggacctgattcaaggcaatcgccccagctatgcgctctccgacatgcga
gttcctctccaggtaggaagtgtggacgcctactatgtcgatgttattggcaacatttcg
acgtcccgattccgatccaacaagcgagaggctctcctcgagctgaagctccgataccct
ctgttcggcggctggaaggcccccttcactatcggatggaactcagatgcttctaacttc
ttgcgcaagaccgcgactggaggttacgttcttcgagttcctttcatcgagggccccaag
cagcttgagggtgtcgagtatgagcaagtcaacatcaacgtccttctccccgagggtgct
gtgaacgtcaagtactacgccaacgttcccgagtcatccatcatgtcaacctcgattgat
ctgacccgaacttacctcgacaccgtcggcagaacacacatcaacatcaaggcgagaaac
ctagttgacgaattccgggatcgacacctcatcatctcctacgacgcgcctttgtcaagc
gctcttcgaaagcctctgattgtctttgccagtgcgatggcggtcttcgtgactacctgg
gctcttggtcaactgcaggtggaatttaagcagaagaaatag

DBGET integrated database retrieval system