KEGG   Fusarium graminearum: FG00500.1Help
Entry
FG00500.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K00844  
hexokinase [EC:2.7.1.1]
Organism
fgr  Fusarium graminearum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FG00500.1
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FG00500.1
   00051 Fructose and mannose metabolism
    FG00500.1
   00052 Galactose metabolism
    FG00500.1
   00500 Starch and sucrose metabolism
    FG00500.1
   00520 Amino sugar and nucleotide sugar metabolism
    FG00500.1
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    FG00500.1
Enzymes [BR:fgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     FG00500.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 572 aa AA seqDB search
MVGLGPRRPPSRKAVACSRYCHGGAEPAKMSCNDDVGSINPDRGVRRQKQDEALHDFTEI
TILGKPAVQDREPMSLTFRACPNAGFYYGGSQRGSMADVPKDLAEEINKLENLFTVQPSK
LKEITNHFVSELAKGLSVEGGSIPMNPTWVMSYPDGYETGTYLALDMGGTNLRVCQITLT
DEKSEFDIIQSKYRMPEELKSGTSEELWEYIAECLYQFLETHHGDCTKLEKIPLGFTFSY
PATQNYIDEGILQRWTKGFDIDGVEGQNIVPMFEEALKTRGVPIKLAAIINDTTGTLIAS
AYTDTAMKIGCIFGTGCNAAYMEDCGSIPKIADLNLPADLPMAINCEWGAFDNEHKVLPR
TPYDVIIDKESPRPGQQAFEKMIAGLYLGEIFRLILVDLHDNKSIHIFENQDIALLRKPY
SLDASFLSAIEEDPWENLSETSDLFSKKLNLKCTQPELELIRRTAELIGTRAARLSACGV
AAICKKKNYQSCHVGADGSVFNKYPHFKERGAKALRDILDWPEKTNKKEEDPIEVLTAED
GSGVGAALIAALTLKRINEGNMAGILHPENFK
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggtcggtcttggtcctcgtcgccctccctcccgaaaggctgttgcttgttcgagatac
tgccatggtggggcagaaccagcaaaaatgagctgcaatgacgatgttggctccatcaat
cctgaccgtggggtcagacgtcagaagcaagacgaagccctgcatgatttcacggagatc
acgatattgggaaagccagcagtgcaggatcgagagcccatgtcattgactttccgagct
tgtccaaatgccggcttctactatggtggcagccagcgcggatccatggccgatgtcccc
aaggacctcgctgaagagatcaacaagctcgagaatctcttcaccgtacagcccagcaag
ctcaaggagatcaccaaccatttcgtttctgaactcgccaagggtctcagcgttgagggt
ggtagcattcctatgaatcctacctgggtcatgtcatacccggatggctatgaaaccggc
acctacctggccctcgacatgggcggcaccaacctgagagtgtgccagatcacacttact
gacgagaagtccgagttcgatatcatccagtccaagtaccgcatgcctgaggagctcaag
tctggcacctctgaggagctttgggagtacattgccgaatgtctctaccagttccttgag
acacaccacggagactgcacaaagttggagaagatccctctgggtttcacattctcgtac
cccgccacccagaactacatcgatgagggtatcctccagcgatggaccaagggcttcgac
attgacggtgtcgagggccagaacattgttcccatgttcgaggaggccttgaagactcgg
ggcgttcctatcaagcttgccgctatcatcaatgatactaccggcacattgattgcctct
gcctacaccgatactgccatgaagattggttgcattttcggcactggttgtaacgccgca
tacatggaagactgcggctcaatccccaagattgctgacctgaacctccctgctgacctg
cctatggccatcaactgcgaatggggagctttcgacaatgagcataaggtcctcccccga
accccctacgacgtcatcattgacaaggagtctcctcgccctggacagcaggcttttgag
aagatgattgctggtctgtaccttggcgagatcttccgactcattctcgtcgacctccac
gacaacaagtctatccatatctttgagaaccaagacattgctctcctccgcaagccttat
tctctggatgcctccttcctgtctgctatcgaggaggacccctgggagaacctgtccgag
accagcgacctcttcagcaagaagctgaacttgaagtgcacacagcctgagcttgagctt
atccgcagaaccgccgagctcatcggcacacgagctgcccgcctctcggcctgtggcgtt
gctgctatctgcaagaagaagaactaccaatcttgccacgtcggtgctgacggttccgtg
ttcaacaagtacccccacttcaaggagcgtggtgccaaggctctgcgagatattctcgac
tggcccgagaagaccaacaagaaggaagaggatcccattgaagtcctgactgccgaggac
ggtagcggtgtcggcgccgccctgattgccgccctgacgcttaagcgcatcaatgagggc
aacatggcgggtatccttcatcccgagaacttcaaataa

DBGET integrated database retrieval system