KEGG   Fusarium graminearum: FG00524.1Help
Entry
FG00524.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
fgr  Fusarium graminearum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:fgr00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:fgr00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:fgr00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:fgr00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 513 aa AA seqDB search
MANIIKSALPTHLKPNTGDEQGNERRHGKTRSHMAFENTSTNVAAAQMRNALTNLAETLF
ETEMDNFFALFRRYLNDKAKGNAVDWDRIAPPAQGQVVDYDDLANTESVQFLNKLAVLKL
NGGLGTSMGCVGPKSVIEVRDGMSFLDLSVRQIEYLNRTYDVNVPFILMNSFNTNDDTAA
IIKKYEGHNVDILTFNQSRYPRVYKDSLLPVPKDNDSPINEWYPPGHGDVFESLYNSGIL
DKLLERGIEIVFLSNVDNLGAVVDLRILQHMMETDSEYIMELTNKTKADVKGGTIIDYEG
SVRLLEIAQVPKEHVNEFKSIKKFKYFNTNNIWLNLKAIKRVVENDELEMEIIPNGKTIP
GDKKGESDISIVQLETAVGAAIRHFNNAHGVNVPRRRFLPVKTCSDLMLVKSDLYTLKHG
QLQMSAARFGDAPLIKLGGDFKKVSDFQKRIPSIPKVLELDHLTITGAVNLGRGVTLKGT
VIIVATEGSTIDVPPGSILENVVVQGSLRLLEH
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggccaatattatcaagagcgcgctgcctacccacctcaagcccaacaccggcgatgag
cagggcaacgagcgtcgtcatggcaagacacgcagtcacatggctttcgagaacacctcg
accaacgtcgccgccgctcagatgcgaaatgctctgaccaacctcgccgagaccctgttc
gagaccgagatggacaacttctttgccctgttccgacgttacttgaacgacaaggcgaag
ggtaacgcagtagactgggatcgtattgcacctcccgcccagggccaggtcgtcgactac
gatgaccttgccaacaccgagtctgtccagttccttaacaagctcgctgttctcaagctc
aacggtggtctgggaacctctatgggttgcgttggccccaagtccgttatcgaggtccgt
gatggtatgtccttcctcgacctttccgtgcgacagatcgagtacctcaaccgcacatac
gacgtcaacgtccctttcatcctcatgaactctttcaacacaaacgacgacaccgctgcc
atcattaagaagtacgagggccacaacgtcgatatcctcaccttcaaccagtcccgatac
ccccgagtctacaaggactctctcctccctgtccccaaggacaacgactctcccatcaac
gagtggtacccccctggtcacggtgatgttttcgagtctctctacaactctggcattctt
gacaagctcctcgagcgaggtatcgagatcgtcttcctgtccaacgtcgacaacctgggc
gctgttgtcgatctccgtatcctccagcacatgatggagaccgactccgagtacatcatg
gagttgaccaacaagaccaaggccgatgtcaagggcggtaccattatcgactacgagggc
tccgttcgcctgcttgaaatcgcccaggttcccaaggagcacgtcaacgagttcaagtcc
atcaagaagttcaagtacttcaacaccaacaacatctggctcaacctcaaggctattaag
cgtgtcgtggagaatgacgagcttgagatggagattattcccaacggcaagactatcccc
ggtgacaagaagggagagtccgacatctccatcgttcagctcgagaccgctgtcggtgct
gccattcgtcacttcaacaatgcccacggtgttaacgtcccccgtcgacgattcttgcca
gtcaagacttgctctgacctcatgctcgtcaagtctgatctctacacactgaagcacggt
cagcttcaaatgagcgccgcccgcttcggtgacgcccccttgatcaagctcggtggtgac
ttcaagaaggtctcggacttccagaagcgaatcccctccatccccaaggtgttggagctg
gaccacctcaccatcactggtgccgtcaacctcggccgtggtgtgacgctcaagggcact
gtcatcatcgttgctacagagggcagcaccatcgacgtcccacctggatctatccttgag
aacgttgtcgtgcagggtagcttgcgtctgcttgagcattaa

DBGET integrated database retrieval system