KEGG   Fusarium graminearum: FG00926.1Help
Entry
FG00926.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
fgr  Fusarium graminearum
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:fgr00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 331 aa AA seqDB search
MFARSAFRAAQPLRSVRRYATEAGGAGGSNALLYAAGAAALGGAGYWYFGKSGAPVAAAA
QDVKQAVGVEPKAAFTGGDQGWVSLKLSDVEIVNHNTKRLRFELPEADQVSGLHVASALL
TKYKGPNDEKATLRPYTPISDETDKGFLDLLIKKYPNGPMSTHLHDMAPGQRLDLKGPLP
KYAWEENKHDHIALIAGGTGITPMYQLARAIFNNPKDKTKVTLVFGNVSEQDILLKKQFE
ELENTYPQRFRAFYVLDNPPKGWAGGSGFISKDLLKTVLPEPKNENIKLFVCGPPGLMNA
ISGNKVSPKNQGELTGALKELGYKEDQVYKF
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcccgatctgcattccgcgccgctcagcctttgaggtctgttcgtcgatatgcc
accgaggctggaggtgctggtggttccaatgccctcctctacgctgctggagctgctgcc
cttggtggtgctggttactggtactttggcaagagcggagctcccgttgctgccgctgct
caggacgtgaagcaggctgttggtgtcgagcccaaggcggctttcaccggtggtgatcag
ggttgggtctccctcaagctctctgacgtcgagattgtcaaccacaacaccaagcgtctg
cggttcgagcttcctgaagctgaccaagtctctggtctgcacgttgccagtgctcttctc
acaaagtacaagggccctaatgacgagaaggccaccctacgaccctacacccctatcagc
gatgagaccgacaagggcttcctcgacttgcttatcaagaaataccctaacggccccatg
agcacacacctgcacgacatggctcctggtcagcgactcgacctcaagggccccctgccc
aagtacgcctgggaggagaacaagcacgaccacatcgccctcatcgctggtggcaccggt
attactcccatgtaccagctcgcccgcgccatcttcaacaaccccaaggacaagaccaag
gtcactcttgtatttggcaacgtcagcgagcaagacatcctcctcaagaagcaattcgag
gagctcgagaacacctaccctcagcgcttccgagccttctacgtcctcgacaaccctccc
aagggctgggctggtggcagtggcttcatctccaaggaccttctcaagactgttcttcct
gagcccaagaacgagaacatcaagcttttcgtctgcggtcctcccggtctcatgaacgcc
atctccgggaacaaggtcagccctaagaaccagggtgagctgaccggtgctctcaaggag
ctcggctacaaggaggaccaggtttacaagttctga

DBGET integrated database retrieval system