KEGG   Fusarium graminearum: FG01245.1Help
Entry
FG01245.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
fgr  Fusarium graminearum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 358 aa AA seqDB search
MASATRQFARAATRATRNGFAIAPRQVIRQQGRRYYSSEPAQKSSSAWIWLTGAAVAGGA
GYYFYGNSASSATAKVFNPSKEDYQKVYNEIAARLEEKDDYDDGSYGPVLVRLAWHASGT
YDKETGTGGSNGATMRFAPESDHGANAGLAAARDFLQPVKEKFPWITYSDLWILAGVCAI
QEMLGPAIPYRPGRSDRDVSGCTPDGRLPDASKRQDHLRGIFGRMGFNDQEIVALSGAHA
LGRCHTDRSGYSGPWTFSPTVLTNDYFRLLVEEKWQWKKWNGPAQYEDKSTKSLMMLPSD
IALIEDKKFKPWVEKYAKDNDAFFKDFSNVVLRLFELGVPFAQGTENQRWTFKPTHQE
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggcctctgctacccgacagtttgcccgcgcggccactcgtgccactcgcaatggcttc
gctattgctccccgacaggttatccgtcagcagggtcgccgctactactcttccgagccc
gcacagaagtcctcttcggcatggatttggttgacaggtgctgccgttgctggaggtgct
ggctactacttctacggcaacagtgcttcttctgctaccgccaaggtcttcaaccctagc
aaggaggactaccaaaaggtttacaacgagattgccgctcgcttggaggagaaggacgac
tacgacgatggcagctatggtcccgttctagttcgtcttgcctggcacgccagtggcacc
tacgacaaggagactggtaccggtggcagcaatggagctaccatgcgattcgctcctgag
tctgaccacggtgccaacgccggtctggccgctgcccgtgacttccttcagcctgtcaag
gagaagttcccttggatcacctactcggatctctggatccttgccggcgtttgtgctatc
caggagatgctgggtcccgctatcccttaccgacctggccgttccgaccgcgatgtctct
ggctgcacacccgatggccgtcttcctgacgcttccaagcgccaggatcatctccgcggt
atcttcggccgtatgggtttcaacgatcaagaaatcgttgccctctctggtgcccacgct
ctgggccgatgtcacaccgaccgttccggctacagtggcccttggactttctcccccact
gtcctgaccaacgactacttccgcctcctcgttgaagagaagtggcagtggaagaagtgg
aacggccctgctcagtacgaggacaagtccaccaagtctctcatgatgcttcccagcgac
attgctcttattgaggacaagaagttcaagccttgggttgagaagtacgccaaggacaac
gacgctttcttcaaggacttctccaacgtcgtcctccgactattcgagctcggagttcct
tttgcccagggtaccgagaaccagcgatggaccttcaagcccacccaccaggaataa

DBGET integrated database retrieval system