KEGG   Fusarium graminearum: FG01246.1Help
Entry
FG01246.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
fgr  Fusarium graminearum
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:fgr04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 1085 aa AA seqDB search
MSSQIHNKAAAGVPYFTPAQEPPAGTPLKTDLVPTLFKPLRTRGVELQNRFVVSPMCTYS
AQDGHLTDFHLVHLGQFALQGAGLVFVEATAVEPRGRISPEDSGLWDDSQIVPLKRITDF
IHSQNTKAAIQLAHAGRKASTVAPWIGGSVNKALATKEVGGWPDDIAAPSAIPFADDYGT
PHELTTEEIKTLVKQWQESAVRAVKAGFDVIEIHAAHGYLVHQFLSPLTNKRTDQYGGSF
ENRTRLLFEIIEAVRAVVPEELPLWVRISATEWMEWNNEPSWDLESSIDLAKQLPALGVD
VLDISSGGNFKAQKIKVRQTLQTDLAGKIREALRADGKELLIGTVGYITDGPFARSLVEE
KEDPKADLVLAARQFLREPDFVLSAADQLDVDVKWPIQYHRATPKNRCFELHRYAHHTTK
IDMAVTLVAGILAYCVSKECEVIYFSSQVIFHENTYTTSVGTLVVRRTCRSFPINEVHSQ
AGDNPTNAPGFKVLYSRLEDLAHPPRVSSAAALEGPCWAAAAAPAAWSQINGKRRASATC
HQAKGTLVHLKDGPRTFPPPFLSGSWLRARIPPTRQPIMHHKKIACSFMAALAAYASAAD
SDVSQLTKDTFDEFVKSNDLVLAEFFAPWCGHCKALAPEYEEAATTLKEKNIRLAKIDCT
EESDLCKEHGVEGYPTLKVFRGLENVTPYSGQRKAAGITSYMIKQSLPAVSILTKDTLEE
FKTADKVVVVAYLNTDDKSSNETFSKLAESLRDTYLFGGVNDAAVAEAEGVKAPALVVYK
AFDERKNTFTEKFEEQAISAFISTSATPLIGEVGPETYAGYMSAGIPLAYIFSETEEERK
ELGEALKPIAEKYKGKINFATIDAKAFGAHAGNLNLKTDKFPSFAIQEVVKNQKFPFDQE
KEITHDNIAKFVEQFDAGKIEPSIKSEPIPETQEGPVTVVVAKSYNDIVLDDTKDVLVEF
YAPWCGHCKALAPKYDDLASQYAASEFKDKVVIAKVDATLNDVPDEIQGFPTIKLYPAGA
KDAPVTYQGSRTVEDLANFVKENGKYKAEISIKEEGTEEAAPAASEEKKEEKKAEKADED
VHDEL
NT seq 3258 nt NT seq  +upstreamnt  +downstreamnt
atgagtagccagattcacaacaaagcagctgccggggttccttacttcaccccggcccag
gaacctccggccggtaccccgctcaagaccgatttggtgccgactctgtttaagccactc
cgtacgcggggtgttgagctccagaaccgctttgtcgtttctcccatgtgcacctactcg
gctcaggatggtcacttgacagattttcatctcgtccaccttgggcaatttgctctgcaa
ggtgccggtcttgtgttcgttgaggctactgctgtcgaacctcgtgggcgtattagtcct
gaggactcgggtctctgggacgatagccagatcgtgcctctcaagcgtatcacagacttc
atccacagtcagaacacgaaagctgcaattcaacttgcacatgctggcagaaaagcgagc
acagttgcaccctggattggtggttccgtgaacaaagcacttgccactaaggaagtcgga
ggttggcccgatgatatcgctgcgcctagtgctattccatttgctgatgactatggaacg
ccgcatgaattgaccaccgaagagatcaagacccttgtgaaacagtggcaagagtctgct
gtacgagctgtaaaggctggattcgatgtaattgagatccacgcagctcatggttacctt
gtccaccagtttctttcgcctctcaccaacaaacgaacggatcagtatggcggaagtttt
gagaaccgtacccgcctgctattcgagatcatcgaagccgttcgcgctgttgttcccgag
gagttgcccctctgggtgcgtatttctgccacagagtggatggaatggaataatgaacca
tcttgggacctcgagagcagcattgatctcgctaagcaacttccagcattgggggtcgac
gttcttgatatcagcagcggtggcaactttaaggcgcaaaagatcaaggttcgccagacg
ctccagaccgacctcgcaggtaagatccgtgaggcattgcgtgctgacggcaaggaactt
ctgatcggaacagttggatatatcactgatggtcctttcgctcgatcgttggttgaagag
aaggaggatccaaaggccgatctcgtgcttgctgcaagacagttccttagggagccagac
tttgtgctcagcgccgcagatcaactggatgttgatgtcaagtggccgattcagtatcat
agggcaaccccaaagaaccgttgctttgaactgcataggtatgctcaccatacaaccaag
attgacatggccgtcaccttagttgctggtatactcgcatactgtgtcagcaaggagtgc
gaggttatatactttagcagtcaggtcatattccatgagaacacatatacgacgtcagtt
ggtaccttggtcgttcgtcgaacatgtcgttcgtttcctatcaatgaggttcacagccag
gcaggtgacaatcccaccaatgcccctggcttcaaggtcctctacagccgcctggaggat
ttggcgcatcctcctcgagtgtcctccgccgccgctttggaggggccgtgctgggctgca
gctgcagctccggcggcatggagccagatcaacgggaaaagacgtgccagtgctacctgc
caccaagcaaaagggacacttgttcacttgaaagatggaccccggacgtttcctccacct
tttcttagcgggagttggctccgggcccggatacccccaaccagacagcccatcatgcac
cacaagaagatcgcctgcagctttatggctgctttggctgcctatgcctctgctgccgac
tccgatgttagccagcttaccaaggacacatttgacgagttcgtcaagtccaacgatctt
gtcctcgctgagtttttcgctccctggtgcggtcactgcaaggcccttgcccccgaatac
gaggaggctgccactaccctcaaggagaagaacatcaggctcgccaagattgactgcact
gaggagtctgacctctgcaaggagcacggcgttgagggttaccccaccctcaaggtcttc
cgtggccttgagaatgtcactccctactccggtcagcgcaaggctgctggtatcacctca
tacatgatcaagcagtccctccccgctgtttccatcctcacaaaggacaccctcgaggag
ttcaagaccgccgacaaggtcgttgtcgttgcttacctcaacaccgatgacaagagctcc
aacgagaccttctccaagcttgctgagagtctccgtgacacctacctcttcggtggcgtc
aacgacgccgctgttgccgaggctgagggtgtcaaggcccccgccctggttgtctacaag
gctttcgatgagcgcaagaacaccttcacagagaagtttgaggagcaggccatctctgct
ttcatctctacttccgctactcccctcattggtgaggttggccctgagacatacgctggt
tacatgtccgctggtatcccccttgcttacatcttctctgagaccgaggaggagcgcaag
gagctcggcgaggctctcaagcctatcgcagagaagtacaagggcaagatcaacttcgcc
accatcgatgctaaggctttcggtgcccacgctggtaacctgaacctcaagaccgacaag
ttcccctctttcgccatccaagaggttgtcaagaaccagaagttccccttcgaccaggag
aaggagatcacccacgacaacatcgccaagttcgttgagcagttcgacgctggcaagatt
gagcccagcatcaagtctgagcccatccccgagacccaggagggtcccgtcacagttgtt
gttgccaagagctacaacgatatcgtccttgatgacaccaaggatgtccttgttgagttt
tacgctccctggtgtggtcactgcaaggctctcgctcccaagtacgatgaccttgcttct
cagtacgctgcttctgagttcaaggacaaggttgtcatcgccaaggttgacgccaccctg
aacgacgtccccgatgagatccagggtttccctaccatcaagctctaccccgctggtgcc
aaggacgctcccgttacttaccagggctctcgaaccgtcgaggacctcgccaacttcgtc
aaggagaacggcaagtacaaggctgagatctccatcaaggaggagggtacagaggaggct
gcccctgccgccagtgaggagaagaaggaggagaagaaggccgagaaggccgacgaggat
gttcatgatgagctgtaa

DBGET integrated database retrieval system