KEGG   Fusarium graminearum: FG01246.1Help
Entry
FG01246.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
fgr  Fusarium graminearum
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    FG01246.1
Enzymes [BR:fgr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     FG01246.1
Exosome [BR:fgr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   FG01246.1
  Exosomal proteins of colorectal cancer cells
   FG01246.1
  Exosomal proteins of bladder cancer cells
   FG01246.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 1085 aa AA seqDB search
MSSQIHNKAAAGVPYFTPAQEPPAGTPLKTDLVPTLFKPLRTRGVELQNRFVVSPMCTYS
AQDGHLTDFHLVHLGQFALQGAGLVFVEATAVEPRGRISPEDSGLWDDSQIVPLKRITDF
IHSQNTKAAIQLAHAGRKASTVAPWIGGSVNKALATKEVGGWPDDIAAPSAIPFADDYGT
PHELTTEEIKTLVKQWQESAVRAVKAGFDVIEIHAAHGYLVHQFLSPLTNKRTDQYGGSF
ENRTRLLFEIIEAVRAVVPEELPLWVRISATEWMEWNNEPSWDLESSIDLAKQLPALGVD
VLDISSGGNFKAQKIKVRQTLQTDLAGKIREALRADGKELLIGTVGYITDGPFARSLVEE
KEDPKADLVLAARQFLREPDFVLSAADQLDVDVKWPIQYHRATPKNRCFELHRYAHHTTK
IDMAVTLVAGILAYCVSKECEVIYFSSQVIFHENTYTTSVGTLVVRRTCRSFPINEVHSQ
AGDNPTNAPGFKVLYSRLEDLAHPPRVSSAAALEGPCWAAAAAPAAWSQINGKRRASATC
HQAKGTLVHLKDGPRTFPPPFLSGSWLRARIPPTRQPIMHHKKIACSFMAALAAYASAAD
SDVSQLTKDTFDEFVKSNDLVLAEFFAPWCGHCKALAPEYEEAATTLKEKNIRLAKIDCT
EESDLCKEHGVEGYPTLKVFRGLENVTPYSGQRKAAGITSYMIKQSLPAVSILTKDTLEE
FKTADKVVVVAYLNTDDKSSNETFSKLAESLRDTYLFGGVNDAAVAEAEGVKAPALVVYK
AFDERKNTFTEKFEEQAISAFISTSATPLIGEVGPETYAGYMSAGIPLAYIFSETEEERK
ELGEALKPIAEKYKGKINFATIDAKAFGAHAGNLNLKTDKFPSFAIQEVVKNQKFPFDQE
KEITHDNIAKFVEQFDAGKIEPSIKSEPIPETQEGPVTVVVAKSYNDIVLDDTKDVLVEF
YAPWCGHCKALAPKYDDLASQYAASEFKDKVVIAKVDATLNDVPDEIQGFPTIKLYPAGA
KDAPVTYQGSRTVEDLANFVKENGKYKAEISIKEEGTEEAAPAASEEKKEEKKAEKADED
VHDEL
NT seq 3258 nt NT seq  +upstreamnt  +downstreamnt
atgagtagccagattcacaacaaagcagctgccggggttccttacttcaccccggcccag
gaacctccggccggtaccccgctcaagaccgatttggtgccgactctgtttaagccactc
cgtacgcggggtgttgagctccagaaccgctttgtcgtttctcccatgtgcacctactcg
gctcaggatggtcacttgacagattttcatctcgtccaccttgggcaatttgctctgcaa
ggtgccggtcttgtgttcgttgaggctactgctgtcgaacctcgtgggcgtattagtcct
gaggactcgggtctctgggacgatagccagatcgtgcctctcaagcgtatcacagacttc
atccacagtcagaacacgaaagctgcaattcaacttgcacatgctggcagaaaagcgagc
acagttgcaccctggattggtggttccgtgaacaaagcacttgccactaaggaagtcgga
ggttggcccgatgatatcgctgcgcctagtgctattccatttgctgatgactatggaacg
ccgcatgaattgaccaccgaagagatcaagacccttgtgaaacagtggcaagagtctgct
gtacgagctgtaaaggctggattcgatgtaattgagatccacgcagctcatggttacctt
gtccaccagtttctttcgcctctcaccaacaaacgaacggatcagtatggcggaagtttt
gagaaccgtacccgcctgctattcgagatcatcgaagccgttcgcgctgttgttcccgag
gagttgcccctctgggtgcgtatttctgccacagagtggatggaatggaataatgaacca
tcttgggacctcgagagcagcattgatctcgctaagcaacttccagcattgggggtcgac
gttcttgatatcagcagcggtggcaactttaaggcgcaaaagatcaaggttcgccagacg
ctccagaccgacctcgcaggtaagatccgtgaggcattgcgtgctgacggcaaggaactt
ctgatcggaacagttggatatatcactgatggtcctttcgctcgatcgttggttgaagag
aaggaggatccaaaggccgatctcgtgcttgctgcaagacagttccttagggagccagac
tttgtgctcagcgccgcagatcaactggatgttgatgtcaagtggccgattcagtatcat
agggcaaccccaaagaaccgttgctttgaactgcataggtatgctcaccatacaaccaag
attgacatggccgtcaccttagttgctggtatactcgcatactgtgtcagcaaggagtgc
gaggttatatactttagcagtcaggtcatattccatgagaacacatatacgacgtcagtt
ggtaccttggtcgttcgtcgaacatgtcgttcgtttcctatcaatgaggttcacagccag
gcaggtgacaatcccaccaatgcccctggcttcaaggtcctctacagccgcctggaggat
ttggcgcatcctcctcgagtgtcctccgccgccgctttggaggggccgtgctgggctgca
gctgcagctccggcggcatggagccagatcaacgggaaaagacgtgccagtgctacctgc
caccaagcaaaagggacacttgttcacttgaaagatggaccccggacgtttcctccacct
tttcttagcgggagttggctccgggcccggatacccccaaccagacagcccatcatgcac
cacaagaagatcgcctgcagctttatggctgctttggctgcctatgcctctgctgccgac
tccgatgttagccagcttaccaaggacacatttgacgagttcgtcaagtccaacgatctt
gtcctcgctgagtttttcgctccctggtgcggtcactgcaaggcccttgcccccgaatac
gaggaggctgccactaccctcaaggagaagaacatcaggctcgccaagattgactgcact
gaggagtctgacctctgcaaggagcacggcgttgagggttaccccaccctcaaggtcttc
cgtggccttgagaatgtcactccctactccggtcagcgcaaggctgctggtatcacctca
tacatgatcaagcagtccctccccgctgtttccatcctcacaaaggacaccctcgaggag
ttcaagaccgccgacaaggtcgttgtcgttgcttacctcaacaccgatgacaagagctcc
aacgagaccttctccaagcttgctgagagtctccgtgacacctacctcttcggtggcgtc
aacgacgccgctgttgccgaggctgagggtgtcaaggcccccgccctggttgtctacaag
gctttcgatgagcgcaagaacaccttcacagagaagtttgaggagcaggccatctctgct
ttcatctctacttccgctactcccctcattggtgaggttggccctgagacatacgctggt
tacatgtccgctggtatcccccttgcttacatcttctctgagaccgaggaggagcgcaag
gagctcggcgaggctctcaagcctatcgcagagaagtacaagggcaagatcaacttcgcc
accatcgatgctaaggctttcggtgcccacgctggtaacctgaacctcaagaccgacaag
ttcccctctttcgccatccaagaggttgtcaagaaccagaagttccccttcgaccaggag
aaggagatcacccacgacaacatcgccaagttcgttgagcagttcgacgctggcaagatt
gagcccagcatcaagtctgagcccatccccgagacccaggagggtcccgtcacagttgtt
gttgccaagagctacaacgatatcgtccttgatgacaccaaggatgtccttgttgagttt
tacgctccctggtgtggtcactgcaaggctctcgctcccaagtacgatgaccttgcttct
cagtacgctgcttctgagttcaaggacaaggttgtcatcgccaaggttgacgccaccctg
aacgacgtccccgatgagatccagggtttccctaccatcaagctctaccccgctggtgcc
aaggacgctcccgttacttaccagggctctcgaaccgtcgaggacctcgccaacttcgtc
aaggagaacggcaagtacaaggctgagatctccatcaaggaggagggtacagaggaggct
gcccctgccgccagtgaggagaagaaggaggagaagaaggccgagaaggccgacgaggat
gttcatgatgagctgtaa

DBGET integrated database retrieval system