KEGG   Fusarium graminearum: FG01281.1Help
Entry
FG01281.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
fgr  Fusarium graminearum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:fgr00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 592 aa AA seqDB search
MSRSRAESTAAALLGSAARSTTKPHLQVSLRRLNGFRSLSTCSASVLTRRRPIVACKHTQ
SFNDGRRYVSQAKDANIAVIGGGLTGLSAAYYLAKKLPSTTKITLYEASDRLGGWIKTDR
VPVDIGGKRGIVSFERGSRSLTSLAGNTFRFDDLVLYDLTLDLGLSLNFPPAKPRYVYYP
DHLVSMPPNVSIFDIIREPLYLESIGAGLGLMINHLRKRHLPAEDESVADWLYKVTNSRK
GIGNMASAMMHGIYGGDIHKLSARSVLDRIYWGWYLPNPGLHARPMPVPESLILETLGQD
RQIQKLALEPKSALIDFGDKGMESLPQAIGAALQDQPNVTIKTGEAVKDIQYDEAKQQVQ
INSFSAKNEEKSNSQAYDKVISTLSAQQIARLASDKVPSLSAAHSVSVMTVNIWFPQENL
KPPGFGYLIPNSVDPELNPEHALGVFFDSDVGTRSKDEPAGTKLFVLMGGHYYDRPDVTP
PTEEEAVVQARNLLERHLGIPRDAPAYATANFAKECIPQHYVGHQGLLRNAHAELKQNFG
GRLAVAGGSFHRIGTIAGLRSGYDAAVAAKSGLEATGLEATEGDKVTMPVQY
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcagtcgagcagaatcaacggctgcagctctcttgggctcagcagctcgttca
acaacgaaaccccacctacaagtatccctccgtcgactcaatggcttccgcagcctcagc
acctgctcagcctcggtcttgacccggcgacgacccattgtcgcatgtaagcatacacaa
agcttcaacgatggaaggagatatgtgtcgcaggcaaaggatgcaaatattgcggtaatt
ggaggcggattaacaggtctttcggcggcatactacctcgcaaagaaacttccctcaacg
acaaagatcaccttgtatgaagccagtgatcggctaggaggatggatcaagacggataga
gtgccagtagatatcgggggcaaaagaggaatcgtgtcttttgagcgcggttctcgttcg
ttgacgtccctggctggcaatactttccgcttcgatgacctcgtcctctacgatcttact
cttgacctaggcctctctctcaactttcccccagccaagccacgatatgtctattacccc
gaccatcttgtttccatgcccccgaacgtcagcatcttcgatattatccgcgagcccctc
tacctcgagagcatcggcgcaggccttggccttatgatcaaccacctgcgcaagagacat
ctccctgccgaagacgaatccgttgccgattggctttacaaagtcaccaacagtcgcaag
ggcattggcaacatggcctcagctatgatgcacggcatctacggcggcgatatccacaag
ctaagcgctcgaagtgttttggatcgcatctactggggttggtatctaccaaaccctggt
ttgcatgcgcgccctatgcctgtacctgagtcgctgattctcgagacgctgggacaggat
cgacaaattcaaaagctggcgttggagcccaagagtgcgctgatagattttggcgataag
ggcatggagtcactgccgcaagcgataggtgcggctttgcaagatcaacccaatgttaca
atcaagaccggcgaggctgtcaaagatatccagtatgatgaggccaagcaacaagtccag
atcaacagtttcagcgccaagaacgaggagaaaagtaactcgcaggcctacgacaaggtc
atttcaacactatcagcccagcagatcgcccgactcgcaagtgataaagtaccatcgctc
tccgccgcacactctgtctctgtcatgacagtcaacatttggttccctcaggagaacctt
aagcctcccggcttcggatatctcatccccaactccgttgacccagagctcaacccagaa
catgccctcggtgtcttctttgactcagacgttggaactcgatccaaagacgaacccgcc
ggtaccaagctgttcgtcctgatgggaggtcattactacgaccgccctgatgttactccc
cctactgaggaggaagctgttgttcaagctcgcaacctactagagcgtcacctcggcatc
ccacgcgatgctcccgcctatgccacagcaaattttgccaaggaatgtatccctcagcac
tacgtcggacaccagggcctcctgcgtaacgctcacgccgagctgaagcagaactttggc
gggcgccttgccgttgctggaggctcgttccatcgcatcggcactattgccggtctgcgc
tctggctacgatgctgctgttgcggcgaagagtggtcttgaagctactggtctggaagcg
acggaaggagacaaggttacaatgccggttcagtactaa

DBGET integrated database retrieval system