KEGG   Fusarium graminearum: FG01283.1Help
Entry
FG01283.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
fgr  Fusarium graminearum
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    FG01283.1
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    FG01283.1
   00603 Glycosphingolipid biosynthesis - globo series
    FG01283.1
   00604 Glycosphingolipid biosynthesis - ganglio series
    FG01283.1
   00511 Other glycan degradation
    FG01283.1
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     FG01283.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 674 aa AA seqDB search
MWSKAILAVAAFALTPANAIWPVPKKISTGDKALFIDQTIDITYNGDFVCWTFPGSDSNS
GACNHTAQLNTETLLHKQIPYTYNYQPDAGSKFTSKQIVQAGVSRALQGVFQDNFVPWML
RERDSDFEPDLQKKQWVKSLKITQTEEDDESTFKPLNGEVDESYSLSLSEKGEASIKAKS
STGVLHGLETFVQLFFKHSSGTSWYTPHAPVSIQDEPEYPHRGILLDVARSFFEVKHIKR
TIDAMSWSKLNRLHLHITDSQSWPLEIPALPKLAEKGAYRKGLTYSPEDLAGIYEYGIHR
GVEVIMEIDMPGHIGVVELAYKDLIVAYNEKPYQWWCKEPPCGAFRMNSSDVYDFLDTLF
DDLFPRISKYSPYFHLGGDELNHNDSRLDPDVRSNKTEVLAPLLQKFVDYTHGKVRDAGM
TPFVWEEMITEWNMTLGKDVVVQSWLGGGAIKTLAEAGHKVIDSDYNFWYLDCGRGQWLN
FDNGNAFQTYYPFNDWCGPTKSWRLIYSHDPRAGLSEEAAKRVLGGEAAVWTETIDSVNL
DTIVWPRAAVMGEVLWSGRTDASGQNRSQYDAAPRLAEMRERMVARGFVLSLLNRESFSI
FHITQYHSFLLTENGDGDCGAGFSVPGAAPWSGRPRCDVANQPRSRQACGASHSSEQCVP
FNTQVNHRGAADPG
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgtggtccaaggctatcctggccgttgccgccttcgccctcacccctgccaatgctata
tggccagtgccaaagaagatctctactggagacaaggccctcttcatcgatcaaacgatt
gatatcacctataatggagactttgtatgctggactttccccggttctgattccaattct
ggtgcttgtaaccacaccgcgcagctcaatactgaaactttgcttcacaaacagattccc
tacacttacaactaccaacccgatgctggctccaagttcaccagcaagcaaatcgtccaa
gccggcgtctctcgtgccctccagggcgtcttccaggacaactttgtcccatggatgctc
cgtgaacgcgactccgattttgaacctgacctgcaaaagaaacaatgggtaaagtcgcta
aagattacccagaccgaggaggatgacgaaagcaccttcaagcctctcaatggcgaggtt
gacgagtcgtactccctttcgctttctgaaaagggcgaggcttccattaaggccaagtcc
tctacaggtgtcctgcacggacttgagacctttgtccaacttttcttcaagcacagctct
ggcacttcctggtacacaccacacgcgcctgtctcgatccaggacgagccagagtaccct
caccgaggtattcttctcgacgtagcccgtagcttttttgaagtcaagcacatcaagcgc
acgatcgatgccatgtcgtggagcaagctgaatcgtcttcaccttcacatcactgactcg
cagtcctggcctctcgagatcccagccctgcccaagttggccgaaaagggcgcgtaccgc
aaaggattgacctattctcccgaggaccttgctggtatatatgagtatggtatccatcgt
ggagtcgaggtcattatggagattgacatgcccggtcatattggtgtcgttgagcttgct
tacaaggatctcattgtcgcgtacaatgagaagccttatcaatggtggtgcaaggagcca
ccctgtggtgcgttccgcatgaacagctctgatgtttatgactttctcgacactctcttc
gatgacctcttccctcgtatttccaagtacagcccttacttccatctcggtggagacgag
ctcaaccacaacgattccagacttgatcctgatgtgcgctccaacaagactgaggttctg
gcgcctcttttgcaaaaatttgtcgattacactcacggcaaggttcgagatgctggcatg
actccgttcgtctgggaggagatgattaccgagtggaacatgactctgggcaaagacgtt
gtggtccagtcctggctcggtgggggtgctatcaagaccctggccgaggcaggtcacaaa
gtaatcgatagcgattacaacttttggtaccttgactgtggtcgtgggcagtggctcaac
tttgacaacggcaatgcctttcaaacatactaccccttcaacgactggtgcggtcctacc
aagagctggcggctcatctactcacacgaccctcgggccggtctgtctgaggaggcggcc
aaacgcgtgcttggtggtgaggcggccgtatggactgagactattgacagtgtcaacctc
gacaccatcgtgtggccccgcgctgctgtaatgggagaagttctctggtcaggtcgaact
gacgcttctggccagaacagatcacagtatgatgctgcgccgcgactggcggagatgcgc
gagcgtatggtggctcggggttttgttctcagccttttgaacagagaatctttttccatc
tttcacattacgcagtaccactcattcctcttaactgaaaacggagatggggattgcggg
gccggattctcggtgccaggagcggctccgtggtcaggccggccccgatgtgacgtcgca
aaccaacccaggtcaagacaagcatgcggagcaagtcattcatccgaacaatgtgtgccg
ttcaatactcaagttaatcatcggggtgccgcggaccccggatag

DBGET integrated database retrieval system