KEGG   Fusarium graminearum: FG01343.1Help
Entry
FG01343.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
fgr  Fusarium graminearum
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    FG01343.1
Translation factors [BR:fgr03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    FG01343.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 543 aa AA seqDB search
MPRRETGSKRHKPNQTKPKRRAKISVLSLTSARTQATGSARKTFPMNLMRLKKLWQPHQD
SCLRCRLPKDHPSLPDVNCIRIHRYFELEINWLWYIHIDIDVEGKVNNKPGYKPSNKLSC
WKIHRPVLYRSQPNINTHPLQAHNLGTAPHTKLHFPLPHSRALKHNCDFKLPQTTKHNPP
SKTDIPTDIMPPKKWDEEESEDSSSSAAPAVGAAAIAARRKFDDEEDEGDVLDSWDADDS
EAEREKERKATEAKQKAAAAAAAAKKPKGLRIAQHQAERAQQKAEAEESDEYEETEGEKR
ERLRRTEQEADLAHAADMFGDIGISANRSKARPATVVVDANDPTKTVDISKLPLFQPKTK
LQFETLRTSIAPLISANAKSAHYSLFLQDFTKALAKDMNSEQIKKLASSMTALGNEKMRE
EKAADKGGKKSKAAKTKTSLVTGRANVADTTTYDDNDDFGDNTRRRPLAPGSDPPLPAST
CTLPPPSNCLPTRHAVDAKMTIKSRGVASQPSRLLEGRSRGVWRRCSVRERQHACKSGQC
PKD
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgccacgaagagagaccgggagcaaacgccacaagcctaaccaaaccaagcccaagaga
cgagccaaaatctcggtcctgtcactgacatccgcaaggacccaggcaaccggaagcgct
agaaagacgttcccgatgaacttgatgaggctcaaaaagctgtggcagccacatcaagac
tcatgtttacggtgtcgactgccgaaggaccaccctagtttgcctgacgtcaactgtatc
cgtatccacaggtactttgagttagaaatcaactggctttggtatatacatatcgatata
gatgttgaaggcaaagttaataataagcctggttacaaacctagcaataaacttagttgt
tggaagatccatcgacccgttttgtaccgtagccagcccaacatcaacacccacccacta
caggcgcacaacttgggcaccgcaccacacacaaaacttcatttccctctgccacattca
cgcgccctaaaacataactgcgacttcaaactcccgcaaaccaccaaacacaacccgccg
tcaaagaccgatataccgaccgacatcatgcctcctaagaagtgggatgaagaggagagc
gaagacagctcctcctctgctgctcctgccgttggtgccgccgccattgctgctcgccgc
aagttcgacgatgaagaagatgaaggagatgtcctagattcgtgggatgccgatgactcc
gaggccgagcgtgaaaaggagcgcaaggctaccgaggccaagcagaaggctgctgccgcc
gccgcagctgccaagaagcccaagggtctgcgaatcgcccagcaccaagccgagcgtgct
cagcagaaggctgaagctgaggaatccgatgaatacgaggagaccgagggcgagaagcgt
gagcgactccgacgcaccgagcaggaggccgatctcgcacacgctgccgatatgtttgga
gatattggaatcagtgccaaccgttccaaggctcgtcccgctaccgtcgttgtcgacgcc
aatgatcccaccaagaccgtcgacatctccaagctacctctcttccagccaaagacaaag
ctccagttcgagaccctccgaacaagtatcgcccctctcatctcagccaacgcaaagagc
gcccactactctctgttcctccaagacttcaccaaggcccttgccaaggatatgaacagc
gaacagatcaagaaactcgctagcagcatgactgctttgggtaacgaaaagatgagggag
gagaaggctgccgacaagggcggcaagaagtcaaaggctgccaagaccaagacctccctc
gtcactggccgtgctaacgtcgcggacactaccacctacgacgacaacgatgactttgga
gataacacacgaaggagacctctcgcccctggttccgacccgccgcttccagcctcgact
tgtacactcccgccgccgtccaactgtttgccaactcggcatgccgtcgacgcaaagatg
acaatcaagtcccgcggcgtcgcctcgcaaccctctcggttactcgagggcagaagcagg
ggagtatggcggaggtgctctgtgagggaaaggcagcatgcatgcaaaagtggtcaatgc
cctaaagattga

DBGET integrated database retrieval system