KEGG   Fusarium graminearum: FG01353.1Help
Entry
FG01353.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K11483  
histone deacetylase HOS2 [EC:3.5.1.98]
Organism
fgr  Fusarium graminearum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 502 aa AA seqDB search
MDIDSYRYRVPKPNYLPHIPDDDRDNSLVEEYSNTPLGLASEMDNAKFYNKCKRLAEESG
ITRPKGYNVSFHCNPDIEEHHFGVTHPMKPWRLTLSKSLIYSYGMSFAMDNYISRSATYE
ELNEFHSSDYLDFLGTVLPEPVPRDLENQGVDLKFNLGGSDCPLFDGLFNYCSLSAGGSL
DAARKICSKQSDIAISWGGGLHHAKRSEASGFCYINDIVIAILQLLRHFPRVLYIDIDVH
HGDGVEEAFFSTDRVMTVSFHKYDPNNFFPGTGALDDNGPKSEHNPGAHHAFNVPLNDGI
TDEQYDHLFNTVIGKIVEKFRPGAIALQCGADSLAGDRLGRFNLQVQGHGACVKFCKDMG
IPMILFGGGGYTPRNVARAWTYETSIAINAQDKINPILPEHAPWRDHFRQDTLFPTLEQI
LGEPRVNKNPPKRLQDIVQHVTEQLRFVEAAPSVQFQTIPPDLGGVRDDVEERIKEENEE
RRDEIRKAREAAVGAVGTAMQL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggatatagactcctacaggtatcgggtgccaaagccgaactatcttccacacatacca
gacgatgatcgcgataactctcttgtggaagagtactccaacactccgctcggcttagcc
agtgagatggacaatgccaaattttacaacaaatgcaaacgtctcgccgaggaatctggc
atcacccggcccaagggatacaatgtatccttccactgtaacccggacatcgaggaacat
cactttggcgtcactcatcctatgaaaccctggcggttaacgctttccaagagcctcatt
tactcttacggcatgtcttttgccatggacaattatatctcaaggtcggctacgtacgag
gaactcaacgagtttcactcttcggactatttggacttcctcggcacagtactgcctgag
ccagtaccacgagacctcgagaatcaaggagtcgacctgaagttcaacctgggtggatct
gactgtcccctctttgatggcctcttcaactattgttctttgtccgctggcgggtctctt
gacgcagccagaaagatttgctcaaagcagtctgatatcgccatctcctggggtggcggc
cttcaccacgccaagagatctgaagcgtccgggttttgctatatcaatgatatcgttatt
gctattctccaactccttcgccattttccccgagtcctgtacatcgacattgatgttcat
cacggcgacggagtagaagaagccttcttctcgaccgatagagtcatgacagtctcattc
cataaatacgacccaaacaacttcttccctggtactggcgctcttgatgacaacggtccc
aagagcgagcacaacccgggcgctcaccacgctttcaatgtgcccttgaatgatggtatc
actgatgaacaatacgatcatttattcaataccgtgattggcaaaattgttgaaaagttc
cgaccgggcgccatcgcactgcaatgtggtgctgactctttagccggtgaccgtctcggt
cgctttaaccttcaggttcaagggcacggagcttgtgtcaagttctgtaaagacatgggt
attcccatgattctttttggaggtggcgggtatactccccgaaacgtggccagggcctgg
acatatgagaccagtatcgctatcaacgcccaggacaagatcaaccccatccttccagag
catgccccttggcgcgatcatttccgacaggataccttgttccctactttggaacaaatc
ctaggtgaaccacgcgtgaacaaaaaccctccgaaacgcctgcaagatatcgtacaacac
gtcacagaacaacttcgctttgtagaggcagcaccaagcgttcaattccagacgatacct
cccgaccttggtggtgttagagatgatgtcgaggaacggatcaaggaggaaaacgaagaa
agacgggatgagatccgcaaagcacgagaagctgcagtaggagcggtaggaactgcaatg
caactctag

DBGET integrated database retrieval system