KEGG   Fusarium graminearum: FG01535.1Help
Entry
FG01535.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
fgr  Fusarium graminearum
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    FG01535.1
Enzymes [BR:fgr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     FG01535.1
Glycosyltransferases [BR:fgr01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   FG01535.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 741 aa AA seqDB search
MAAADKAAVASGADLGDGLRQRPIAGQANLQPPTPQPEDNKKLIKKEPSFLDTLDRWEVV
IAPLIFTLLALFTRLYKIGISNIVTWDEAHFGKFGSYYIKHEYYFDVHPPLGKMLVGLSG
VLAGYNGTFEFKSGEKYPEEVNYTIMRIFNAAFGILCIPLAYFTARELRLKRPAVWLVTL
MVLCENSYTTISRFILLDSMLLCGTVATVFCWSKFHNQRNNSFDPEWFFWLFMTGLSIGC
VCSVKLVGLFVTALVGLYTIEDLWRKFGDTKMPVTTLGAHVVTRVVGLIVIPFLIYLLSF
ALHFAILDRSGPGDAQMSSLFQANLKGTQVGKDSPLEIAIGSRATIKNMGYGGGLLHSHV
QTYPEGSKQQQVTCYHHKDTNNDWFFYPNRREEDYSPEGDLRFIGDNSVIRLIHAQTGRN
LHSHDIAAPITRGHKEVSSYGNLTVGDEKDHWKVEVIRDTASRDRSKIRTLTTAFRLKHE
VLGCYLRAGNVNLPQWGFKQIEVTCTKENNPRDTYTHWNVEAHWNDKLPPAEAGVYKSPF
FHDFVHLNVAMMTSNNALVPDPDKQDDLASKWWQWPFLHVGLRMCGWGDDIVKYFLLGNP
LIYWGSTASLGIAGLVIVWYILRWQRGVNDLSEKEIDHIHYAALYPLAGWFLHYLPFVIM
ARVTYVHHYYPALYFAILNFGFLIDWFTRNRNNTIKSIVYGVLYTVIIGLYIYFIPICWG
MTGPHKEYKYMKWFDNWRVTD
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgccgacaaggctgccgtcgcctccggcgctgatctgggcgatggtctcaga
cagcgtcccattgctggacaagccaacctgcagcccccaactcctcagcctgaggacaac
aagaagctcataaagaaggagccttcgttcctcgataccctcgatcgatgggaggtcgtc
attgccccgctgatctttacactcctggctcttttcactcgactatacaagattggtatc
agcaacattgtgacatgggatgaggctcatttcggcaagttcggttcatactatatcaag
catgagtactacttcgatgtccaccctcctctcggaaagatgcttgttggtctatccgga
gtcctcgctggctacaacggaactttcgaattcaagtctggcgagaaataccccgaagaa
gtcaactacaccatcatgcgtatcttcaacgccgcttttggtattctctgcattcctctg
gcctacttcactgctcgcgagctcaggctcaagcgtcctgctgtctggcttgtgactctc
atggtcctttgcgagaactcatacaccactatcagtcgattcatcctgcttgattctatg
cttctctgcggtactgtggccactgtgttctgctggtccaagttccacaaccagcgcaac
aacagcttcgatcctgagtggttcttctggcttttcatgactggtctcagcattggctgt
gtctgcagtgttaagcttgtcggtctcttcgttactgctcttgttggtctctacactatt
gaggacctctggcgaaagtttggcgacaccaagatgcctgttacaactcttggtgcccat
gtcgtcacccgcgttgtcggtcttatcgtcattcctttcctgatctacctcctgtctttc
gcccttcacttcgctatcctcgaccgcagtggtcctggtgacgctcagatgagctccctt
ttccaagccaatctcaagggtactcaggtaggaaaggacagccctctggaaatcgcaatt
ggttctcgcgcaaccatcaagaacatgggttatggtggtggtcttctccactctcacgtc
cagacctaccctgagggttctaagcagcagcaggttacttgttaccaccacaaggacacc
aacaacgactggttcttctaccccaaccgtcgagaggaggattacagccccgagggtgat
ctccgatttattggcgacaactctgttatccgacttatccacgctcagaccggccgcaac
ctgcactcccacgacattgctgctcccatcacccgaggccacaaggaggtttccagctac
ggtaacctgactgttggtgacgaaaaggaccactggaaggttgaggtcatccgcgacact
gcctctcgtgaccgcagcaagatccgcactctcaccaccgccttccgtctcaagcatgaa
gttcttggatgctacctccgagctggtaacgtgaacttgcctcagtggggtttcaagcag
atcgaggttacctgcaccaaggagaacaacccccgcgatacctacacccactggaatgtt
gaggctcactggaacgacaagcttcctcctgccgaggctggtgtctacaagtctcctttc
ttccacgactttgtccacctgaatgtcgccatgatgacctccaacaacgctctggttccg
gatcccgataagcaggatgaccttgcctccaagtggtggcagtggcccttcctccacgtt
ggtcttcgtatgtgcggttggggcgacgacattgtcaagtacttccttctcggcaaccct
ctcatctactggggttctaccgcctctctcggcattgccggactcgtcattgtttggtac
attctacgatggcagcgaggcgttaacgacctctccgagaaagagatcgatcatattcac
tacgcagccttgtaccctctcgctggctggttcctccactaccttccttttgttatcatg
gctcgtgtcacttacgtgcaccactactaccctgctctttactttgccatcctcaacttt
ggcttccttatcgattggttcacacgcaaccgcaacaacaccatcaagtccatcgtttac
ggcgtcctgtacaccgttatcattggcctttacatctacttcatccctatttgctggggt
atgactggtccccacaaggagtacaagtacatgaagtggttcgacaactggcgagtcacc
gactaa

DBGET integrated database retrieval system