KEGG   Fusarium graminearum: FG01618.1Help
Entry
FG01618.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
fgr  Fusarium graminearum
Brite
Enzymes [BR:fgr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     FG01618.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 285 aa AA seqDB search
MAIIEGWLPPTRENYNLIFTVWQIAFPVIGSMQWLTKWYGMGKTSVSSCLNLPGRIGWMT
MEAPGALTLMYLMKVLPEQHGIDDLPWQNKVLAGLFVIHYSYRAVMFPLLQPSMSPLHIA
VWLLAFSFQMFNATCLGSWLAAYGPVTEEEWSSQSSVLQFSAGILIFYLGLSGNFFHDEE
LRDIRRREMQRQERVKLEQNGNSNGKQSNGNKGAEKHYQIPQAGLFRVGWVLDGSGLGMR
ACEGVSRERAVLDVPSGCEGKEMIDMTAGLMRTDGKSRKGTAESM
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggctattattgaagggtggttaccacccactcgggaaaactacaatctcatctttaca
gtctggcagatcgcttttccggtgattggttcaatgcaatggcttaccaagtggtatggc
atgggcaaaacttcagtctccagctgtcttaacctgccaggccgcataggctggatgact
atggaagctccgggtgctttgacgctcatgtacctgatgaaagttcttcctgagcaacat
ggaatcgacgatctgccgtggcagaacaaggtccttgcgggtttgtttgtgattcactac
tcttaccgcgcggtcatgttccccttactacagccgtccatgtcgcctttgcacattgct
gtgtggttgctggctttcagctttcagatgttcaacgcgacatgtctgggctcgtggctt
gcagcttacggacctgtcacggaagaagagtggtcatcgcagtcatcagttctgcagttc
tcagcaggaattctaatattctatcttggtttgtctggaaactttttccacgacgaagag
ctccgtgatatccgccggcgggagatgcagcgtcaggagcgcgtcaagctggagcagaac
ggtaacagcaacggcaagcagagcaatggtaataagggagcggagaagcactaccagatt
ccgcaggcgggcctatttcgagtgggctgggttctggatggcagcgggttggggatgcgg
gcctgcgagggcgtttctcgtgaacgagctgttctcgatgttccctcgggctgtgagggg
aaagagatgattgatatgacagctgggttgatgagaaccgatggcaagagccgaaaggga
acagccgaaagtatgtaa

DBGET integrated database retrieval system