KEGG   Fusarium graminearum: FG01803.1Help
Entry
FG01803.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
fgr  Fusarium graminearum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    FG01803.1
  Lipid metabolism
   00561 Glycerolipid metabolism
    FG01803.1
   00600 Sphingolipid metabolism
    FG01803.1
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    FG01803.1
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     FG01803.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 744 aa AA seqDB search
MVLLTLKRISTAAVVLGQSLAALAESSSPIHVDGTSFALNGDNVSYRFHVDNTTGDLIND
HYGGPIAGDTITAEVGPVQGWVNLIGRVRREFPDHGRGDFRLPAFQIQQASGTTVTDFRY
KSYDLVQGKPGLPGLPATFGDAEDVSSLVVHMYDNYSSIAVDLTYSIFPKYDAIVRSVNI
TNKGNTTINLKKVASWSVDFGQEDLDLIELRGDWSREGMRVRRKVDYGTQGFQSSTGYSS
HLHNPFLALVSPDTTESQGEAWGFSLVYTGSFAVDVEKSSQGLTRALLGINPIDFSWPLK
PGKTFTTPEVVSVFSNKGVGGMSRQFHRLYRKHLMKSKFAEETRPALLNSWEGLAFDINE
TSIYKIAKQSADLGIKLFVMDDGWFGNKYARTIDKLGLGDWQPDKSRFPEGLTPLVEDVT
QLKVANSSEKLKFGIWFEPEMVNPESDLYNAHPDWALHSGSYPRTETRWQLVLNLALPEV
QEFIIDSVSKILNESPISYVKWDNNRGIHETPDQTLNYKYMIGLYHVFEVLTSRFPDVLW
EGCASGGGRFDPGVLQWFPQIWTSDDTDAVERIAIQFGTSLAYPPSSMGAHLSHVPNGLT
GRTTSVKFRAHVAMMGGSFGVELDPSDLEAEERDQIPGLIQLSEKINPIVITGDFYRLAL
PEDTKYPAAQFISEDGKKVVLFAFQTRATINFSWPWFRMQGLDADAKYVLDGNQTVSGST
LMNLGVQLRFEGDYDSQVLIFEKQ
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggtcctgctcacactcaagcgcatctctacggctgcggtagtcttgggccaatccctc
gccgctttggctgagagttcgagtccaatccatgttgatgggacgtccttcgctctcaac
ggagacaatgtctcatatcgcttccatgtcgacaacaccacaggtgatctaatcaacgac
cactatggcggtcctatcgcaggagataccatcacagctgaagtcggtcctgtccaaggc
tgggttaatctcatcggtcgagtccgacgcgagttcccggaccatggaagaggagacttc
cgactaccagctttccagatccaacaagccagtggcactacagtcacagactttcgctac
aagtcatacgacctcgtgcagggaaagcccggtttgcccggtcttccagccacgtttgga
gatgctgaggatgtctcaagtcttgttgtgcacatgtatgacaactacagctccatcgcc
gtggacctgacatattccatcttccccaaatatgacgctatcgtgcgaagcgttaatatt
accaacaaaggaaacacaactatcaatctcaaaaaggttgctagttggagtgttgacttt
ggacaagaggatctagatcttattgagcttagaggtgactggtcccgtgagggaatgcga
gtacgtcgtaaggttgattatggcacacaagggttccaaagttcaaccggatactcttcc
caccttcacaacccttttctcgcactcgtttcaccagacaccactgagtcccaaggcgaa
gcttggggcttttcattagtctacaccggctcattcgcagttgatgtcgaaaagagctca
caaggtctcacccgcgctcttctcggtatcaaccccatcgatttctcatggcctctcaag
cctggtaaaactttcaccacacccgaagttgtatccgttttctcaaacaagggtgtcggt
ggcatgtcgagacaattccatcgcctttacagaaagcacctgatgaagagcaagtttgcc
gaagaaaccagacctgccctcctcaacagctgggagggcttggcatttgacatcaatgag
acatccatctacaagatcgcgaagcaatctgcagaccttggtatcaaactctttgtcatg
gacgacggctggttcggtaacaagtatgctcgaacgattgataagctcggtcttggtgat
tggcagcctgacaagtctcgctttcctgaaggacttactccccttgttgaggatgttaca
cagcttaaagtagcgaattcctctgaaaagctcaagtttggtatctggtttgagccagaa
atggtgaatccagagtcagacctgtataacgcgcatcctgactgggctctccactctgga
tcatatccccgaacagaaactcgttggcaacttgttctcaaccttgctttgcccgaggtc
caagagtttatcattgactctgtttctaaaattctcaacgagtcgccgatttcctacgtc
aagtgggataacaaccgtggcatccatgagactcctgatcagaccctcaactacaagtac
atgataggattgtatcacgtttttgaggtgctcaccagccgtttccctgatgttctttgg
gaaggttgtgcgtctggaggtggtcgattcgaccctggcgttcttcagtggttcccccag
atctggacatctgacgatacagacgcagttgagcgtatcgcgatccaatttggcacttcg
ctagcttatcctccatcttcaatgggcgcccatctctcacacgtccctaacggactcact
gggcgtacaacgtctgtcaagtttagagcccacgttgccatgatgggtgggtcattcgga
gttgaactcgatcccagtgatctggaagcggaagagagggatcaaattcccggtctcatc
cagctatctgaaaagatcaacccaatcgtcattacaggtgatttctaccgattagctctc
cctgaagacaccaagtacccagccgcgcagttcatctctgaagacggcaagaaggttgtt
ctgttcgctttccagactcgagcgacgatcaacttttcctggccttggttccgtatgcag
ggtttggatgccgatgccaaatatgtattggacggaaaccagactgtgtctggctcgacg
cttatgaaccttggtgttcagttacggtttgagggggattatgatagtcaggttttgata
tttgagaagcagtga

DBGET integrated database retrieval system