KEGG   Fusarium graminearum: FG01829.1Help
Entry
FG01829.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
fgr  Fusarium graminearum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FG01829.1
   00052 Galactose metabolism
    FG01829.1
Enzymes [BR:fgr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     FG01829.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 400 aa AA seqDB search
MFFKTAVVAALLPSVFATKGKGPDKDGKYWLSGDGIKAAFIPYGASITNLLIDDQYGISR
DIVAGFDNATHYSIDKGHPHLGGVPGRYANRIRNSTFEIDGKDYHVKPNDNPTKESPDGA
DTLHGGPDGWDYRNFTVVSYTDSSITFSIVDPDGKEGFPGEVVSYVTYTLEGMDWDIKIV
ALATTKKTPIMLTSHTYWNLDGFSNNETNTVSNHSLHMPYGGQRMDVDNILIPTGDIIAN
KKGSVNDFWSKRKMIGDQENNEDLKNNCGFNCTGYDTCFTVNRGQLGNYDWRTEGPVASL
SSAWSGIQVDIYSDQDAFQFYSCTQQKGDFPLKRTQGLKDNKDFPRTIPKYGCVVLEVQD
YIDGINHPEWMRDQKQIFEPGGDPYVLQAKYTFSLKGGKE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgttcttcaagactgccgtcgttgccgctctcctcccttcggtctttgcgaccaagggc
aagggtcctgataaggatggtaaatactggctctccggagacggtatcaaggctgccttt
atcccttacggcgcctctatcaccaaccttttgatcgatgaccagtacggtatctcccga
gacatcgttgctggcttcgacaacgccacccactacagcatcgacaagggtcaccctcat
ctcggtggtgtccccggacgatacgccaaccgtatccgaaacagcacctttgagattgac
ggcaaggattatcacgtcaagcccaacgataaccctaccaaagagtctcccgatggcgcc
gatacccttcacggtggccctgacggttgggattaccgcaacttcactgttgtgtcctac
accgactcgagcatcaccttctccatcgtcgaccccgatggcaaggagggtttccccggc
gaggttgtgtcctatgtgacatacaccctcgagggaatggactgggacatcaagattgtc
gcattggccaccaccaagaagactcccatcatgttgacctcccacacatactggaacctc
gatggcttctccaacaacgagacaaacactgtttccaaccactccctgcacatgccctac
ggtggccagcgcatggacgtcgacaacatccttattcccactggtgatatcattgccaac
aagaagggatccgtcaatgatttctggagcaagagaaagatgattggagaccaagagaac
aacgaagacctgaagaacaactgcggtttcaactgcaccggatatgacacctgcttcacc
gtcaaccgtggccagctcggtaactacgactggcgcaccgaaggtcccgttgctagtctg
tcttccgcatggtctggcatccaagtcgacatttactccgaccaagatgccttccagttc
tacagctgcacgcaacaaaagggtgacttccctctgaagcgcactcagggtctcaaggat
aacaaggacttccctcgaacaatccccaagtacggatgtgtcgttcttgaggttcaggac
tacattgatggtatcaaccaccccgagtggatgcgtgaccagaagcaaatctttgagccc
ggtggtgatccttatgttctccaggctaaatacactttcagcctgaagggtggcaaggag
tag

DBGET integrated database retrieval system