KEGG   Fusarium graminearum: FG01972.1Help
Entry
FG01972.1         CDS       T01038                                 

Definition
C505_FUSOX Bifunctional P-450:NADPH-P450 reductase (Fatty acid omega-hydroxylase) (P450foxy)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
fgr  Fusarium graminearum
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    FG01972.1
  Amino acid metabolism
   00380 Tryptophan metabolism
    FG01972.1
Enzymes [BR:fgr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     FG01972.1
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     FG01972.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 1069 aa AA seqDB search
MAESVPIPEPPGYPLIGNLGEFKTNPLNDLNRLADTYGPIFRLHLGSKTPTFVSSNAFIN
EVCDEKRFKKTLKSVLSVVREGVHDGLFTAFEDEPNWGKAHRILIPAFGPLSIRNMFPEM
HEIANQLCMKLARHGPHTPVDASDNFTRLALDTLALCAMDFRFNSYYKEELHPFIEAMGD
FLLESGNRNRRPAFAPNFLYRAANDKFYADIALMKSVADEVVATRKQNPTDRKDLLAAML
EGVDPQTGEKLSDDNITNQLITFLIAGHETTSGTLSFAMYHLLKNPEAYNKLQKEIDEVI
GRDPVTVEHLTKLPYLSAVLRETLRISSPITGFGVEAIEDTFLGGKYLIKKGETVLSVLS
RGHVDPVVYGPDAEKFVPERMLDDEFARLNKEFPNCWKPFGNGKRACIGRPFAWQESLLA
MALLFQNFNFTQTDPNYELQIKQNLTIKPDNFFFNCTLRHGMTPTDLEGQLAGKGATTSI
ASHIKAPAASKGAKASNGKPMAIYYGSNSGTCEALANRLASDAAGHGFSASVIGTLDQAK
QNLPEDRPVVIVTASYEGQPPSNAAHFIKWMEDLAGNEMEKVSYAVFGCGHHDWVDTFLR
IPKLVDTTLEQRGGTRLVPMGSADAATSDMFSDFEAWEDTVLWPSLKEKYNVTDDEASGQ
RGLLVEVTTPRKTTLRQDVEEALVVSEKTLTKTGPAKKHIEIQLPSGMTYKAGDYLAILP
LNPRKTVSRVFRRFSLAWDSFLKIQSDGPTTLPINIAISAFDVFSAYVELSQPATKRNIL
ALSEATEDKATIQELEKLAGDAYQEDVSAKKVSVLDLLEKYPAVALPISSYLAMLPPMRV
RQYSISSSPFADPSKLTLTYSLLDAPSLSGQGRHVGVATNFLSQLIAGDKLHISVRASSA
AFHLPSDPETTPIICVAAGTGLAPFRGFIQERAAMLAAGRKLAPALLFFGCRDPENDDLY
AEELARWEQMGAVDVRRAYSRATDKSEGCKYVQDRIYHDRADVFKVWDQGAKVFICGSRE
IGKAVEDICVRLAMERSEATQEGKGATEEKAREWFERSRNERFATDVFD
NT seq 3210 nt NT seq  +upstreamnt  +downstreamnt
atggctgaatctgtgcccattcccgagcctcctggctaccctctcattggaaatctgggt
gaattcaagacgaacccactcaatgatctcaaccgtctggccgacacttatggccccatc
ttcagactgcatctgggttcaaaaacacccacttttgtctcaagcaacgccttcatcaat
gaggtttgcgatgagaagcgcttcaaaaagacgttgaaatctgttctcagtgtcgtacgc
gaaggtgtccacgatggactattcacagccttcgaggatgagcccaattggggcaaggca
catagaattcttattcctgccttcggacctctgagtatcagaaacatgttccccgagatg
catgagattgccaatcaactatgcatgaagctggctcgccatggccctcatacaccagtt
gacgccagtgacaactttactcgtctagcactcgataccttggctctttgtgccatggac
ttccgcttcaactcctattacaaggaggaactgcaccctttcattgaagcgatgggtgat
ttcctcctcgaatcaggaaacagaaatagacgacctgcattcgcacccaactttctctac
cgcgcagccaacgacaagttttacgccgacattgctctcatgaagtcagtagcagacgaa
gtcgttgcgacacgaaagcagaaccccactgatcgaaaagatctgctcgctgctatgctt
gagggtgttgacccccaaacaggcgagaagctatccgacgacaacatcacaaaccaactc
atcacattcctcatcgccggtcatgaaacaacttctggcacgctatctttcgccatgtac
caccttctcaagaacccagaggcctacaacaagcttcaaaaggagatcgacgaggtcatt
ggccgcgaccctgtcaccgtggaacacctcaccaagctgccctacctcagcgccgtgttg
agagagaccctccgaatcagctctcccatcaccggtttcggtgtcgaagctatcgaagac
accttccttggaggaaagtacctcatcaagaagggtgaaactgtgctttctgtcctgtca
agaggtcacgtcgaccccgtcgtgtacggacccgatgccgagaagttcgttcctgaacgt
atgcttgacgacgaattcgccaggttgaacaaagagttccccaactgctggaagcctttc
ggcaacggtaagagagcttgtatcggaagaccattcgcatggcaagagagtcttctcgca
atggctctgctgttccaaaacttcaactttacgcagaccgaccccaactacgaattgcag
atcaagcaaaacctcaccatcaagcctgacaactttttcttcaactgtactctgcgacac
ggcatgaccccaacggatcttgagggtcaactggctggaaagggtgctactactagcatc
gcttcccacatcaaggctcctgcagcatccaagggagccaaggctagcaacggaaagccc
atggctatctactacggctctaacagtggtacctgtgaagctctggctaacagacttgct
tcagatgccgctggtcatggcttcagtgcatcagtcattggtaccttggatcaggccaag
cagaacctccccgaagatcgacccgttgtcatcgtcactgcttcatacgagggtcagcca
ccttccaacgccgctcacttcatcaagtggatggaagacctggccggcaatgagatggaa
aaggtatcgtacgccgttttcggctgtggtcaccacgactgggttgatacattcctccgt
atccccaagcttgtcgataccactcttgaacagcgaggcggtacccgtcttgttcccatg
ggcagtgccgatgctgccactagtgacatgttcagtgactttgaagcctgggaagatacc
gttctctggcccagtctcaaggaaaagtacaacgtcactgacgatgaggcaagtggacaa
agaggtctcttggtcgaagtgacaacaccaagaaagaccactcttcgtcaagacgtcgag
gaagcgctcgtggtctcagagaagacactgacaaagactggtcccgccaagaagcacatt
gagattcagcttccttcgggaatgacctacaaggctggtgattacctcgccatcctgccc
ctgaacccaaggaagacagtgtcgcgggtcttccgaaggttttctctggcttgggattct
ttcttgaagatccaatctgacggtcctaccacactgcctatcaacatcgcaatttctgcc
tttgacgttttcagtgcctatgttgaactttcgcagccggcaacaaagaggaacatcctt
gctctgtctgaggcaaccgaggacaaggcgactatccaggagcttgagaaactcgctggc
gatgcttatcaagaagacgtctcggccaagaaggtttcagttctggacctcctcgagaag
tacccagctgttgctcttcccatcagttcatacctcgccatgcttcctcccatgagagtc
cgacaatactccatctcttcttctcctttcgccgaccccagcaaactcactctcacatac
tccctcctcgacgccccttcactgtccggccagggtcgtcatgttggtgttgccacaaac
ttcctctcccaactcatcgctggcgacaaactccacatctcagtccgcgcctccagcgca
gccttccatcttcccagtgatcccgagaccaccccaatcatctgtgtcgccgccggaact
ggtctcgctcctttccgtggcttcattcaagaacgcgctgctatgcttgccgctggccga
aagctcgctcctgctcttctcttctttggttgccgtgaccctgagaacgacgacctctat
gctgaggaactagcacgctgggagcagatgggcgcggtggatgtccgtcgggcttattct
cgagccaccgacaagtctgaaggttgcaagtacgtccaggaccgtatttaccacgaccgt
gccgacgtgttcaaggtgtgggatcagggtgccaaggtgttcatctgcggcagccgagag
atcggcaaggctgttgaggatatctgcgttcgccttgccatggagaggtcagaggcgaca
caagaaggaaagggtgcgacagaggagaaggcaagggaatggtttgagagaagtagaaat
gagcgttttgctacggatgtgtttgattag

DBGET integrated database retrieval system