KEGG   Fusarium graminearum: FG01972.1Help
Entry
FG01972.1         CDS       T01038                                 

Definition
C505_FUSOX Bifunctional P-450:NADPH-P450 reductase (Fatty acid omega-hydroxylase) (P450foxy)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
fgr  Fusarium graminearum
Pathway
Fatty acid degradation
Tryptophan metabolism
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:fgr00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:fgr00380]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 1069 aa AA seqDB search
MAESVPIPEPPGYPLIGNLGEFKTNPLNDLNRLADTYGPIFRLHLGSKTPTFVSSNAFIN
EVCDEKRFKKTLKSVLSVVREGVHDGLFTAFEDEPNWGKAHRILIPAFGPLSIRNMFPEM
HEIANQLCMKLARHGPHTPVDASDNFTRLALDTLALCAMDFRFNSYYKEELHPFIEAMGD
FLLESGNRNRRPAFAPNFLYRAANDKFYADIALMKSVADEVVATRKQNPTDRKDLLAAML
EGVDPQTGEKLSDDNITNQLITFLIAGHETTSGTLSFAMYHLLKNPEAYNKLQKEIDEVI
GRDPVTVEHLTKLPYLSAVLRETLRISSPITGFGVEAIEDTFLGGKYLIKKGETVLSVLS
RGHVDPVVYGPDAEKFVPERMLDDEFARLNKEFPNCWKPFGNGKRACIGRPFAWQESLLA
MALLFQNFNFTQTDPNYELQIKQNLTIKPDNFFFNCTLRHGMTPTDLEGQLAGKGATTSI
ASHIKAPAASKGAKASNGKPMAIYYGSNSGTCEALANRLASDAAGHGFSASVIGTLDQAK
QNLPEDRPVVIVTASYEGQPPSNAAHFIKWMEDLAGNEMEKVSYAVFGCGHHDWVDTFLR
IPKLVDTTLEQRGGTRLVPMGSADAATSDMFSDFEAWEDTVLWPSLKEKYNVTDDEASGQ
RGLLVEVTTPRKTTLRQDVEEALVVSEKTLTKTGPAKKHIEIQLPSGMTYKAGDYLAILP
LNPRKTVSRVFRRFSLAWDSFLKIQSDGPTTLPINIAISAFDVFSAYVELSQPATKRNIL
ALSEATEDKATIQELEKLAGDAYQEDVSAKKVSVLDLLEKYPAVALPISSYLAMLPPMRV
RQYSISSSPFADPSKLTLTYSLLDAPSLSGQGRHVGVATNFLSQLIAGDKLHISVRASSA
AFHLPSDPETTPIICVAAGTGLAPFRGFIQERAAMLAAGRKLAPALLFFGCRDPENDDLY
AEELARWEQMGAVDVRRAYSRATDKSEGCKYVQDRIYHDRADVFKVWDQGAKVFICGSRE
IGKAVEDICVRLAMERSEATQEGKGATEEKAREWFERSRNERFATDVFD
NT seq 3210 nt NT seq  +upstreamnt  +downstreamnt
atggctgaatctgtgcccattcccgagcctcctggctaccctctcattggaaatctgggt
gaattcaagacgaacccactcaatgatctcaaccgtctggccgacacttatggccccatc
ttcagactgcatctgggttcaaaaacacccacttttgtctcaagcaacgccttcatcaat
gaggtttgcgatgagaagcgcttcaaaaagacgttgaaatctgttctcagtgtcgtacgc
gaaggtgtccacgatggactattcacagccttcgaggatgagcccaattggggcaaggca
catagaattcttattcctgccttcggacctctgagtatcagaaacatgttccccgagatg
catgagattgccaatcaactatgcatgaagctggctcgccatggccctcatacaccagtt
gacgccagtgacaactttactcgtctagcactcgataccttggctctttgtgccatggac
ttccgcttcaactcctattacaaggaggaactgcaccctttcattgaagcgatgggtgat
ttcctcctcgaatcaggaaacagaaatagacgacctgcattcgcacccaactttctctac
cgcgcagccaacgacaagttttacgccgacattgctctcatgaagtcagtagcagacgaa
gtcgttgcgacacgaaagcagaaccccactgatcgaaaagatctgctcgctgctatgctt
gagggtgttgacccccaaacaggcgagaagctatccgacgacaacatcacaaaccaactc
atcacattcctcatcgccggtcatgaaacaacttctggcacgctatctttcgccatgtac
caccttctcaagaacccagaggcctacaacaagcttcaaaaggagatcgacgaggtcatt
ggccgcgaccctgtcaccgtggaacacctcaccaagctgccctacctcagcgccgtgttg
agagagaccctccgaatcagctctcccatcaccggtttcggtgtcgaagctatcgaagac
accttccttggaggaaagtacctcatcaagaagggtgaaactgtgctttctgtcctgtca
agaggtcacgtcgaccccgtcgtgtacggacccgatgccgagaagttcgttcctgaacgt
atgcttgacgacgaattcgccaggttgaacaaagagttccccaactgctggaagcctttc
ggcaacggtaagagagcttgtatcggaagaccattcgcatggcaagagagtcttctcgca
atggctctgctgttccaaaacttcaactttacgcagaccgaccccaactacgaattgcag
atcaagcaaaacctcaccatcaagcctgacaactttttcttcaactgtactctgcgacac
ggcatgaccccaacggatcttgagggtcaactggctggaaagggtgctactactagcatc
gcttcccacatcaaggctcctgcagcatccaagggagccaaggctagcaacggaaagccc
atggctatctactacggctctaacagtggtacctgtgaagctctggctaacagacttgct
tcagatgccgctggtcatggcttcagtgcatcagtcattggtaccttggatcaggccaag
cagaacctccccgaagatcgacccgttgtcatcgtcactgcttcatacgagggtcagcca
ccttccaacgccgctcacttcatcaagtggatggaagacctggccggcaatgagatggaa
aaggtatcgtacgccgttttcggctgtggtcaccacgactgggttgatacattcctccgt
atccccaagcttgtcgataccactcttgaacagcgaggcggtacccgtcttgttcccatg
ggcagtgccgatgctgccactagtgacatgttcagtgactttgaagcctgggaagatacc
gttctctggcccagtctcaaggaaaagtacaacgtcactgacgatgaggcaagtggacaa
agaggtctcttggtcgaagtgacaacaccaagaaagaccactcttcgtcaagacgtcgag
gaagcgctcgtggtctcagagaagacactgacaaagactggtcccgccaagaagcacatt
gagattcagcttccttcgggaatgacctacaaggctggtgattacctcgccatcctgccc
ctgaacccaaggaagacagtgtcgcgggtcttccgaaggttttctctggcttgggattct
ttcttgaagatccaatctgacggtcctaccacactgcctatcaacatcgcaatttctgcc
tttgacgttttcagtgcctatgttgaactttcgcagccggcaacaaagaggaacatcctt
gctctgtctgaggcaaccgaggacaaggcgactatccaggagcttgagaaactcgctggc
gatgcttatcaagaagacgtctcggccaagaaggtttcagttctggacctcctcgagaag
tacccagctgttgctcttcccatcagttcatacctcgccatgcttcctcccatgagagtc
cgacaatactccatctcttcttctcctttcgccgaccccagcaaactcactctcacatac
tccctcctcgacgccccttcactgtccggccagggtcgtcatgttggtgttgccacaaac
ttcctctcccaactcatcgctggcgacaaactccacatctcagtccgcgcctccagcgca
gccttccatcttcccagtgatcccgagaccaccccaatcatctgtgtcgccgccggaact
ggtctcgctcctttccgtggcttcattcaagaacgcgctgctatgcttgccgctggccga
aagctcgctcctgctcttctcttctttggttgccgtgaccctgagaacgacgacctctat
gctgaggaactagcacgctgggagcagatgggcgcggtggatgtccgtcgggcttattct
cgagccaccgacaagtctgaaggttgcaagtacgtccaggaccgtatttaccacgaccgt
gccgacgtgttcaaggtgtgggatcagggtgccaaggtgttcatctgcggcagccgagag
atcggcaaggctgttgaggatatctgcgttcgccttgccatggagaggtcagaggcgaca
caagaaggaaagggtgcgacagaggagaaggcaagggaatggtttgagagaagtagaaat
gagcgttttgctacggatgtgtttgattag

DBGET integrated database retrieval system