KEGG   Fusarium graminearum: FG01988.1Help
Entry
FG01988.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
fgr  Fusarium graminearum
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:fgr00350]
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:fgr00740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 398 aa AA seqDB search
MRAEFLSLLALNAVSVLAAPKPSTVGASAAEATQLEEIADLAAAAYKTAQKTKAAGTCDW
SKVRVRREWNTLSKNDKKAYIKAVKCLQSKPAKGPADFAAGAKTRFDDFVSTHIDATQTI
HYTGNFLSYHRYYTWLYEEALRNECGYKGTQPYWDWSLTAISGLKKSPLFDGSDTSLSGD
GASTGENPDIVLGASSGLPPVYLKTGNGGGCVTSGPFKDMSVNLGPAALDLPGGKVEANP
DPLAYNPRCLKRDLSDSVNRRFANATSVLNNIVNPKNVFDFQMQMQGVPGTGDIGIHGGG
HYALGGDPGRDVYTSPGDPAFYFHHSMIDRVWWIWQMLDTKNRVNGKDALAGTNTFLNMP
PSADTTFEDSIHLPWLGPDKQIKDLMSTQSGPFCYVYL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgctgaattcctttcactcctggctctcaacgctgtcagcgttttggccgccccc
aagcctagcacagttggtgcctctgctgctgaggctactcagcttgaggagatcgctgat
cttgctgctgccgcttacaagactgcccaaaagaccaaggctgccggcacctgcgactgg
agcaaagtccgcgttcgacgggaatggaataccctttctaagaatgacaagaaggcgtac
atcaaggctgtgaagtgtcttcagtctaagcctgccaagggtcctgcagattttgccgct
ggtgccaagacacgctttgatgatttcgtttccacgcatatagatgcaactcaaacgata
cattacacaggaaacttcctctcctaccaccgttactatacttggttatatgaggaggct
cttcgaaatgagtgtggctacaagggaactcagccttactgggattggtccctcactgcc
attagcggtctcaagaagtcaccactctttgatggcagtgacacgtccctctctggtgac
ggcgcgagcactggcgagaaccctgacattgtgcttggagcctctagcggtcttcctccc
gtgtacctcaagaccggtaacggaggtggctgtgtcacgtcaggtcccttcaaggatatg
agcgttaaccttggccctgcagcccttgacctccctggcggcaaagttgaagccaacccc
gatccccttgcctacaaccctcgttgcctgaagcgtgatctgagcgactctgtcaaccgc
cgttttgctaacgccacgtctgtcctgaacaacattgtcaaccccaagaatgtctttgac
ttccagatgcagatgcagggtgtccccggcactggagacattggtatccatggaggcggt
cactacgccctgggtggtgaccctggtcgcgatgtctacacctcccctggcgaccctgct
ttctacttccaccactccatgattgaccgtgtctggtggatctggcagatgcttgacacc
aagaaccgtgtcaatggaaaggatgctcttgcgggcacaaacaccttcctcaacatgcct
cccagtgctgataccacatttgaggactccatccatcttccttggcttggacccgataag
cagatcaaggatctcatgagcacccaatctggtcctttctgctacgtctacctgtag

DBGET integrated database retrieval system