KEGG   Fusarium graminearum: FG02126.1Help
Entry
FG02126.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
fgr  Fusarium graminearum
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    FG02126.1
  Replication and repair
   03420 Nucleotide excision repair
    FG02126.1
Transcription machinery [BR:fgr03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     FG02126.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 349 aa AA seqDB search
MATEDERYRQSSQFRLWSFSKANLQELRAKTNSLAREQIAPRLATNPPPDFLTPDEEIRL
VKFFTVELIRAAQFCELPTEVRATAAIFLRRFYVTNSVMTYPATDLLKTSLFFGCKAEGF
FYKLNAFSEKFPNTTGEQILAGEFLLCQGIRFAFDVRHPFRALEGAILEFRRRLPDEETR
INKAHAQAREILKFSPLVTDAYFHYAPSQIMMAALSMVDHGLLDILIPSPGQGGNASQDA
VFANMRDKILEAVASCRKMLEEEPPERMTDYWGTPEIVKAMKPLRKKLQKCRDPDRANLV
NLQRARREQVMNKEKKAAEGGEDGTVFGDESRETKRVKLENADPFGPPL
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggaagacgagcgctatcggcaatcgagccagtttcggctctggtccttttca
aaggccaatctacaagaattacgcgcaaagacaaactcgctcgctcgagaacagatcgct
ccccgactcgcgacaaatcctcctccagacttcctcacccccgatgaagaaatccgcctt
gtcaagttctttaccgtcgagcttatccgcgcggctcagttctgtgaactgcctaccgaa
gttcgagcgaccgctgccatttttctccgacgattctacgtgaccaactcggtcatgacc
taccctgcgaccgacctcctcaagacatcgcttttctttggctgcaaggctgagggtttc
ttctacaaactcaatgctttttcggagaagttcccaaacacaacaggtgaacagatcctt
gcaggagagtttctgctctgtcaggggatccgcttcgcatttgacgtgcgacatcctttc
agagcgcttgagggtgccattctggaattcaggcgaagactgcctgatgaagaaacaagg
atcaacaaggcacacgctcaagcgcgtgaaattctcaaattcagtcctttggtgacggat
gcgtattttcactatgcgccaagtcaaatcatgatggcggcgctttccatggttgaccac
ggattactcgacattttgatcccttctccgggccaaggcggcaacgctagccaggatgca
gtgtttgcaaacatgcgggacaagatcctagaagctgtcgccagttgtcgcaagatgctc
gaggaggaaccaccagagaggatgacggattactggggaacgcccgaaatcgtcaaggcg
atgaaacccctgcgaaagaagcttcagaaatgtcgtgatcccgatcgagcgaatcttgtc
aatcttcaacgagccaggcgagagcaagtcatgaacaaagaaaagaaggcagccgaaggt
ggtgaggatggaacggtatttggggatgaatcaagagaaacaaaaagggtgaaactcgag
aatgcagatccttttggccctcctctatga

DBGET integrated database retrieval system