KEGG   Fusarium graminearum: FG02600.1Help
Entry
FG02600.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
fgr  Fusarium graminearum
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    FG02600.1
Enzymes [BR:fgr01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     FG02600.1
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     FG02600.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 211 aa AA seqDB search
MDGTFEIQWSVCHESCNHASLLLRWPSSPYTLILLPDLSTNKKSQGDQRLPHNSGKPVSV
DDLMNIGVYYYHLPELEQVDNLSKEREYKNRDEITVSPQAMGDIYETKVKSFFAEHLHED
EEIRYILGGRGYFDVRSKDDDWVRVLLEKNDLLILPPGIYHRFTTDESNFVHAMRLFKED
PKWTPLNRGPDVDKNEHRQEYVKQFIGESTE
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggatggaacctttgagatccagtggtctgtctgccatgaatcatgcaaccatgcgagc
ttacttctacgatggccttccagtccgtataccctcatcttgctgcccgacctatcgact
aacaaaaagtcacagggcgaccagcgcctcccccacaactctggaaagcccgtcagcgtc
gatgatctcatgaacattggtgtttactactaccatcttcccgagctcgaacaggtcgat
aacctttcaaaggagcgcgaatataagaaccgtgacgagatcaccgtctctcctcaggcc
atgggcgacatttacgagacaaaggtcaagtctttcttcgccgagcacctacacgaggac
gaggagatccgctacattcttggtggacgtggatactttgatgttcgaagcaaggacgat
gactgggtgcgcgttttgctcgagaagaatgacttgcttattctccctcctggtatctac
caccgcttcaccactgacgagagcaacttcgtccatgccatgcgactgttcaaggaggac
cccaagtggacaccactgaaccgcggccccgatgtcgacaagaacgagcaccgacaagaa
tacgtgaagcagttcattggcgagtctaccgagtaa

DBGET integrated database retrieval system