KEGG   Fusarium graminearum: FG02640.1Help
Entry
FG02640.1         CDS       T01038                                 

Definition
(RefSeq) hypothetical protein
  KO
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
fgr  Fusarium graminearum
Brite
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     FG02640.1
Peptidases [BR:fgr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   FG02640.1
Exosome [BR:fgr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   FG02640.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 774 aa AA seqDB search
MACPHLDLIGLTPPDPSQSVYREDCTQCFDSIDDPDGLDVCLQCFNGGCAGERNHDRLHY
ALTQHPLALNIRRTRKVVERDEPPAKMSKLAIAAETEEDRYDTALAVKCLDCNTELDRTN
PKLAPMVDGILKANTFSRKEEVKAWEQELTSCEHILMLQQAPSKKIEQNDLSHCYACDLA
ENLWLCIECGNLGCGRKQMGGVDGNSHALAHSNESGHGVAVKLGSITPEGTADIYCYKCD
DERVDDKLGEHLNHWGIVLAERQKTEKSLTEMQIEQNLKWDFSMTTEDGKELKPLFGPGL
TGLRNLGNSCYLASIVQCLFDMPSFQSRYFQPGADLPIVPEPAADLETQLRKVADGLLSG
RYSKPDTEIAREAATHQKGLAPAMLKHLIGRGHEEFSTMRQQDALEFLQHLFKLITRSSH
SDGKDPTEPFRFVLEQRLQCLGCHKVKYSSNEQDNIFIDVPLEKLPREEGSDGPDAYKPV
SLTQCLDNFTAAEKVELTCSACGSKDGFSKQSLFKTFPDTLVVNARKMTVVNWVPIKVDV
PVLVPDKPFNLDAYLSKGLQPGEEQLPDEPEAKAPAFEPDATAMSQLEAMGFPYNRCARA
LHATGNSDANTAMEWLFGHMEDPDIDAPLDLGAQTGAADTADPEKIETLGAMGFGAPQAK
KALKETGGDLERAVEWLFSHPDDQGDDDAPAEGASSATKEPAGSADLPATFQLRSIVCHK
GTSIHAGHYVAFIRKALGDANVPTWVLFNDEKVVEAHDVDEMRKFAYVYFFKRV
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atggcttgcccgcatctcgacttgatcgggctgacaccccctgatccttctcagtccgta
tatcgcgaagactgcacccaatgttttgactcgatcgatgatcctgatggtctcgatgtt
tgtctgcagtgcttcaacggaggttgtgccggcgagcggaaccatgatagacttcattat
gcgctgacccagcatcctctcgccctcaacatccgccgcactagaaaagtcgtcgaacga
gatgaaccgcctgccaagatgtccaagctggccattgccgccgaaacagaagaggatagg
tacgacacagcactggccgtcaagtgtctcgattgtaacaccgaactcgaccggacgaat
cctaagcttgctcccatggttgacggcatcctcaaggccaataccttttcacgaaaggag
gaggtcaaggcttgggagcaggagttgactagctgtgagcatatcttaatgcttcagcaa
gcgccttccaagaagatcgagcaaaacgacctgagccactgctatgcttgcgatttggct
gagaacctttggctctgtatcgaatgtggcaacctaggatgtggtcgtaagcagatgggt
ggcgttgatggaaactcgcatgcccttgcacactcaaacgagtcgggccatggggttgcc
gtcaagcttggatcaatcacccccgagggtaccgcagatatctattgctacaaatgcgat
gatgagcgagtcgacgacaagctgggcgagcatttgaaccactggggcatcgtgcttgcc
gagcgccaaaagactgagaagagcttgaccgagatgcaaattgaacagaacctcaaatgg
gactttagcatgactactgaagatggaaaggaactgaagcccttattcggacctggtctt
actggcctgaggaaccttggaaacagttgctatctcgccagtatcgttcaatgtttgttc
gatatgccttctttccaatcaagatacttccaacctggcgcggaccttcctattgttcct
gaacctgctgcagacctcgagactcagctgagaaaagtagctgatgggcttttatcagga
cggtattccaagcctgacacagagattgctagagaggctgcaacacaccagaagggcctg
gcacccgcgatgctcaagcaccttatcggacgaggccacgaagaattttctacgatgaga
cagcaggatgcgctcgagtttctccagcatttgttcaagcttatcaccaggtcttctcat
tccgatggaaaagaccctacggaacccttccgcttcgtgctcgaacaaagacttcagtgc
cttggttgccacaaggttaagtacagcagcaacgagcaggacaacattttcatcgatgtt
cccctggaaaagcttcctcgcgaggaaggttcggatggcccagatgcttacaagcctgtg
tctcttacacagtgccttgataacttcacagctgccgaaaaggtcgagttaacatgctct
gcttgcggaagcaaggatggatttagcaagcaatctctattcaagaccttcccggacaca
ctggttgttaacgcgcgaaagatgactgttgtcaactgggttccaatcaaggtggacgtc
cctgtccttgtaccagacaagcctttcaatttggatgcctatctttccaagggattgcag
cccggagaggaacaactgcccgatgagccggaggccaaggcacccgcgtttgagcctgat
gctactgccatgtcgcaattggaagccatgggattcccttacaaccgctgcgcgcgcgct
ctccacgccactggcaactctgacgccaacaccgccatggaatggctgtttggacatatg
gaggaccctgatattgatgcacctcttgatctgggtgctcaaaccggagcggctgatact
gccgatcctgaaaagatcgaaacgctcggagccatgggctttggtgctccacaagccaag
aaggcgttgaaggagactggcggcgaccttgagagagctgtagaatggctattcagccac
cctgatgatcaaggagacgatgatgctcccgccgagggggcttcttctgcaacaaaggag
ccagctggaagcgctgatctgccagcaaccttccagcttaggtcaatcgtgtgccacaaa
ggcaccagtattcatgctggacactatgttgccttcatccgcaaggctttaggagatgcc
aatgtcccgacttgggtccttttcaacgatgagaaggttgtcgaggcacatgatgttgac
gagatgcgcaagtttgcgtatgtgtactttttcaagcgagtctag

DBGET integrated database retrieval system