KEGG   Fusarium graminearum: FG02778.1Help
Entry
FG02778.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
fgr  Fusarium graminearum
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    FG02778.1
Enzymes [BR:fgr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     FG02778.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 340 aa AA seqDB search
MQMATERHFYYHGKEGYQEECSNCHWCQIRSFPTHSTLPVTVVNEQDFEVLPDDFRFIKN
VVLGVGVRQAEDSFHSGCSCDNDAECQFTGCHCLADLDEEDSSEDDDDPFGDFINGMDID
RPRRKAYAYHAHGAKAGLLRSKFHNSKMPIYECHQSCACSINCPNRVVERGRTIPLEIFR
TEDRGWGVRSPVSIRKGQFVDRYLGEIITSTEADRRRSQSAISQRKDVYLFALDKFTDPD
SLDTRLKGPSLEVDGEFMSGPTRFVNHSCEPNMRIFARVGDHADKHIHDLALFAIKDIPR
GEELTFDYVDGVSHEGEEPGEKSHMTPCLCGSKNCRKFLW
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatggcaacggagcgccatttttattatcacggcaaagagggttaccaagaagag
tgcagcaactgtcactggtgtcaaatacggtcctttccaactcactcgactctacctgtc
acggtggtcaacgagcaagactttgaggttctccccgatgatttccgcttcataaaaaat
gtggtactcggtgttggagttagacaggctgaggatagcttccacagcggctgttcctgt
gataacgacgccgaatgccagttcacaggctgccattgtctggccgacctagatgaagaa
gactccagtgaagatgacgatgatccattcggagattttatcaacggaatggatattgac
cggccacgcaggaaggcgtacgcctatcacgcccatggcgcaaaagctggcctcttgcga
tccaagttccacaactccaagatgcccatatacgagtgtcaccagagctgtgcctgtagt
ataaactgccctaaccgcgtcgttgagcgtggcaggactatacctttggaaatatttcgc
actgaagaccgaggatggggagtaaggtcacctgtgtccataagaaagggacagtttgtt
gaccggtatctcggtgagatcatcacatcgacggaagcagatcgccgccgcagtcaatcg
gccatctcacaacgcaaggacgtttaccttttcgcgctggacaaattcaccgacccagac
tcgctcgacacccgactcaaaggaccttcccttgaggttgacggcgagtttatgtctggc
ccaacgcgctttgtcaaccactcctgcgagcccaacatgcgaatctttgcacgcgtgggt
gatcatgctgataaacatatacatgatcttgccttgttcgcgatcaaggatatacccagg
ggagaagagctgacctttgactatgtcgatggagtttcgcatgagggagaagagccagga
gagaaaagtcatatgacgccatgtctatgtggaagcaagaattgtagaaagtttctatgg
tag

DBGET integrated database retrieval system