KEGG   Fusarium graminearum: FG03247.1Help
Entry
FG03247.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
fgr  Fusarium graminearum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    FG03247.1
Enzymes [BR:fgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     FG03247.1
Exosome [BR:fgr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FG03247.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 516 aa AA seqDB search
MPLLNGKANTAFIGAIDQGTTSSRFLIFDPSGDVVATHQIEFKQYYPHPGWHEHDPEELI
SSVEQCIDGAVETFESQGHSREQIKAVGITNQRETTVVWDKTTGKALHNAIVWTDTRSKD
LVRRLKRRLGSSELIGRCGIPLSTYPSVSKLLWLLDNIPEVKDAYERGVLAFGTVDTWLT
YKLNGATDRDVYVSDPSNASRTMFMNLETLKYDEDILDWFRIDDSKITLPRIVRSSDNKA
YGSLAGTSLKGVKITGCLGDQSAALVGQKAFTPGLAKNTYGTGCFLLYNVGTKPVISSHG
LLTTVAFDFGEGNTMYALEGSIAVAGSSVKFLVDNFGFIESSAKLSALAETVEDNGGCTF
VTAFSGLFAPYWIDDARGTIFGITSYTQRGHIARATLEATCFQTKAILDSMEKDSGHALT
ELAVDGGMCNSDLIMQTQSDLIGIPVNRPGMRETTALGAAIAAGFAVGIWKSFDDLKEVN
TQGRTIFKPQIAEEEATKRFGRWTKAVEMSKGWANE
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcctcaacggaaaagcaaacactgcctttattggtgccattgatcagggcact
acaagctcgcgcttcctgatctttgaccccagtggcgatgttgttgccacgcatcagatt
gagttcaagcagtactatcctcatcctggatggcacgagcatgatcctgaggagcttata
agctctgttgaacagtgcattgacggtgccgttgaaacctttgagagccaaggtcactcg
agagagcagatcaaggccgttggtatcacaaaccagcgagagacaactgtcgtctgggac
aagactactggcaaggccctgcacaacgccattgtctggacagacacacgatcgaaagat
ctcgtgcgtcgtctcaagcgccgtcttggctccagcgagctgatcggacgatgtggaatt
cctctctccacatacccatccgtcagcaaactgctctggcttcttgacaacattcccgaa
gtcaaagatgcgtatgagcgcggtgttttggcgtttggaacggtcgacacatggttgacc
tacaagctcaacggcgcgactgatcgcgatgtctacgtttctgacccgtcaaatgcgtca
cgaaccatgtttatgaatcttgagactctcaagtatgacgaggacattcttgactggttc
cgcatcgatgattccaagattacgctgccaagaattgtgcgctcttcagacaacaaggcc
tacggatcactggctggtacatctctcaagggagtcaagatcaccggatgtctgggcgac
cagtctgcagctcttgtcggacagaaggcttttacccccggtctcgccaagaacacgtac
ggcacaggctgcttcttgctatacaatgtgggcacaaagccagtcatttcgtcgcacggc
ctgttgacaacggtcgcctttgactttggcgagggcaacaccatgtacgccctggaaggc
agcatcgcggtggcgggctccagtgtcaagttcctcgtggacaactttggcttcatcgag
tcgtcggccaagctcagcgctttggccgagacggtggaggacaatggtgggtgcaccttt
gttacggcctttagcggcctgtttgcgccgtactggattgacgatgcgcgaggcaccatc
tttggtatcacgtcgtacacgcagcgcgggcacattgcgagggcgacgctcgaggcgacg
tgtttccaaacaaaggccattctcgactcgatggagaaggacagcggacatgccttgacc
gagcttgctgtggacggtggcatgtgcaactcggatctcatcatgcagacccagtcagat
ctcattggaatcccggtcaacagacccggcatgcgtgagacgacagcactgggtgcggcc
attgcagcgggtttcgccgttggtatctggaagagctttgatgacttgaaggaggtcaac
acccaaggccgtaccatcttcaagccgcagattgccgaggaggaggcgacgaagcggttt
ggacgttggaccaaggccgtcgagatgtccaagggctgggccaacgagtga

DBGET integrated database retrieval system