KEGG   Fusarium graminearum: FG03247.1Help
Entry
FG03247.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
fgr  Fusarium graminearum
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:fgr00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 516 aa AA seqDB search
MPLLNGKANTAFIGAIDQGTTSSRFLIFDPSGDVVATHQIEFKQYYPHPGWHEHDPEELI
SSVEQCIDGAVETFESQGHSREQIKAVGITNQRETTVVWDKTTGKALHNAIVWTDTRSKD
LVRRLKRRLGSSELIGRCGIPLSTYPSVSKLLWLLDNIPEVKDAYERGVLAFGTVDTWLT
YKLNGATDRDVYVSDPSNASRTMFMNLETLKYDEDILDWFRIDDSKITLPRIVRSSDNKA
YGSLAGTSLKGVKITGCLGDQSAALVGQKAFTPGLAKNTYGTGCFLLYNVGTKPVISSHG
LLTTVAFDFGEGNTMYALEGSIAVAGSSVKFLVDNFGFIESSAKLSALAETVEDNGGCTF
VTAFSGLFAPYWIDDARGTIFGITSYTQRGHIARATLEATCFQTKAILDSMEKDSGHALT
ELAVDGGMCNSDLIMQTQSDLIGIPVNRPGMRETTALGAAIAAGFAVGIWKSFDDLKEVN
TQGRTIFKPQIAEEEATKRFGRWTKAVEMSKGWANE
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcctcaacggaaaagcaaacactgcctttattggtgccattgatcagggcact
acaagctcgcgcttcctgatctttgaccccagtggcgatgttgttgccacgcatcagatt
gagttcaagcagtactatcctcatcctggatggcacgagcatgatcctgaggagcttata
agctctgttgaacagtgcattgacggtgccgttgaaacctttgagagccaaggtcactcg
agagagcagatcaaggccgttggtatcacaaaccagcgagagacaactgtcgtctgggac
aagactactggcaaggccctgcacaacgccattgtctggacagacacacgatcgaaagat
ctcgtgcgtcgtctcaagcgccgtcttggctccagcgagctgatcggacgatgtggaatt
cctctctccacatacccatccgtcagcaaactgctctggcttcttgacaacattcccgaa
gtcaaagatgcgtatgagcgcggtgttttggcgtttggaacggtcgacacatggttgacc
tacaagctcaacggcgcgactgatcgcgatgtctacgtttctgacccgtcaaatgcgtca
cgaaccatgtttatgaatcttgagactctcaagtatgacgaggacattcttgactggttc
cgcatcgatgattccaagattacgctgccaagaattgtgcgctcttcagacaacaaggcc
tacggatcactggctggtacatctctcaagggagtcaagatcaccggatgtctgggcgac
cagtctgcagctcttgtcggacagaaggcttttacccccggtctcgccaagaacacgtac
ggcacaggctgcttcttgctatacaatgtgggcacaaagccagtcatttcgtcgcacggc
ctgttgacaacggtcgcctttgactttggcgagggcaacaccatgtacgccctggaaggc
agcatcgcggtggcgggctccagtgtcaagttcctcgtggacaactttggcttcatcgag
tcgtcggccaagctcagcgctttggccgagacggtggaggacaatggtgggtgcaccttt
gttacggcctttagcggcctgtttgcgccgtactggattgacgatgcgcgaggcaccatc
tttggtatcacgtcgtacacgcagcgcgggcacattgcgagggcgacgctcgaggcgacg
tgtttccaaacaaaggccattctcgactcgatggagaaggacagcggacatgccttgacc
gagcttgctgtggacggtggcatgtgcaactcggatctcatcatgcagacccagtcagat
ctcattggaatcccggtcaacagacccggcatgcgtgagacgacagcactgggtgcggcc
attgcagcgggtttcgccgttggtatctggaagagctttgatgacttgaaggaggtcaac
acccaaggccgtaccatcttcaagccgcagattgccgaggaggaggcgacgaagcggttt
ggacgttggaccaaggccgtcgagatgtccaagggctgggccaacgagtga

DBGET integrated database retrieval system