KEGG   Fusarium graminearum: FG03406.1Help
Entry
FG03406.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
fgr  Fusarium graminearum
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    FG03406.1
   00500 Starch and sucrose metabolism
    FG03406.1
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     FG03406.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 326 aa AA seqDB search
MKIFATLNFVTAVLAASRTTAPSGCITVKKGGQFGTIQSAVNSLSTTASGSQCIFIDQGT
YNEQVLVSARNAQLTIYGYTTDTSGYAGNKVTITAKKSQADGLNNDGTATLRVKAANFKL
YNVNVANTYGQGSQAVALSAYADSGYYGVALTGFQDTLLAQEGYQLYSKCMIAGATDFIF
GQRASAWFEKNDLRVVSASVGYITANGRDSDSNPSNYVFNNCNIAAAAGNNVANGAYYLG
RPWREYSRVTFQKTSMSAVIHPAGWSIWNKGEENTGHVQFSEFGNTGAGSTGARASFSKK
LSSAVSISTVLTSSYASKGFYDASYM
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaagatctttgcaacactcaacttcgtcactgcggtgctggctgccagccgaactact
gcacccagtggatgtatcacggtcaagaagggaggccagttcggtaccatccaatctgcg
gtcaactctctttcgaccactgcctcgggatcccaatgcatcttcatcgaccagggaacc
tataacgagcaggttcttgtttctgcgcgcaacgcccagttgaccatttacggatacacc
accgacacaagtggctatgctggtaacaaggtcaccatcacagcgaagaagagccaagca
gatggcctcaacaacgacggaacagccacacttcgtgtcaaggctgccaactttaagctg
tacaacgtcaacgtggccaacacttatggacagggcagccaggctgtcgctctgagcgca
tatgccgacagcggatactacggtgtcgctctcaccggtttccaggataccctcctcgcc
caagagggttaccagctgtactccaagtgcatgatcgctggtgccactgactttattttt
ggtcagcgcgcatctgcctggttcgagaagaacgaccttcgcgtcgtctctgcttcagtc
ggctacatcactgccaacggccgagactctgactccaacccgtccaactatgtcttcaac
aactgcaacatcgccgctgctgccggcaacaacgtcgccaacggtgcctactaccttggc
cgaccctggagagaatactcccgtgttacattccagaagaccagcatgagcgctgttatc
caccccgctggatggtcgatctggaacaagggtgaggagaacactggccacgttcagttc
agcgagttcggcaacacaggtgctggctctaccggtgcccgtgcttcattctccaagaag
ctgagctctgctgtttccatctccactgtcctgacatccagctacgcttccaagggcttt
tatgatgcttcttacatgtaa

DBGET integrated database retrieval system