KEGG   Fusarium graminearum: FG03443.1Help
Entry
FG03443.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
fgr  Fusarium graminearum
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    FG03443.1
Enzymes [BR:fgr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     FG03443.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 478 aa AA seqDB search
MAPSIDSLSQTGTTTTIVRPRKQIPIEAPELTTKDKILTDADVWGRAGLGRSWLRSLVGA
SPLFLAPIGSISIFITLVQYEGSFSLFADAVKEYGFWNICAQYGPQITIKGIAAVICWLA
VQAVLYIYLPGENHQGQLTPAGYLLDYKINGLSAWIVTHLLYGGLSWFGILDPGFIPRNW
SSLIGAMNLAGFLISALAFVKAYVVPCHPEDRKFSGSLLYDFFMGIELNPRLGDKFDLKL
FSNGRAGMMVWTLIDFSNMAYQYQNQGYVEPSLILVTALQTLYVLDFFINESWYLRTIDI
AHDHFGMYLIWGCFCFLPTTYTIQGQYLGLYPSSASTPYLAFFFSLGVAGYVLFRVVNHQ
KDMVRRTGGECTIWGKPAECISARFRTSDGRQHTSLLLCSGFWGWSRHANYVGDLLLSFS
TCALVGSTKAVVWWYAVWMLALLIHRCMRDEKRCSVKYGAAWTEYCKRVPWRFIPGIW
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaagcatagatagcctgtcgcagacaggcactacgactacgattgttcggccg
cggaaacagataccaattgaagctccagagctcacgaccaaggacaagatcttgaccgat
gcggacgtttggggtcgtgcaggacttgggcggtcgtggctacgttctctcgttggagct
tcgccgctgtttcttgcgccaatcgggtcgatatctatcttcatcacgctcgttcagtac
gaaggatccttctcactctttgcagacgcagtaaaggaatacggcttctggaacatctgc
gcgcagtacgggcctcaaatcaccatcaagggcattgcggcagtgatttgctggctcgct
gttcaggcagttttgtacatctatctcccgggagaaaaccaccagggacagctcacgcca
gctggatatcttctcgactacaagatcaatggcctctcagcctggatcgtgacgcatctc
ttgtatggcggtctcagctggtttgggattctggaccccggcttcataccccgcaactgg
agtagtttgattggggccatgaacttagctggcttcctcatctcggcacttgcttttgtc
aaagcgtacgtggtgccatgtcatccagaggatagaaagttcagtggatcccttttatat
gatttcttcatgggaattgagttaaatccgcggctgggcgataaatttgacctcaaattg
ttcagcaacggtagagctggaatgatggtgtggactttgatagacttctccaacatggct
tatcagtaccaaaatcaggggtacgttgagccgtcactaattctcgtgacagcgcttcag
acgctctatgtgctagatttcttcatcaatgaatcttggtaccttcggacaatcgacatt
gctcatgatcactttggcatgtatctgatctggggctgcttttgctttctgccaacaaca
tacacgatacaggggcaataccttggtctgtacccatcatcagcctcgactccctacctg
gcattcttcttttcccttggagtagcaggctatgtgctcttccgcgttgtcaatcatcaa
aaagatatggtccgacgaacagggggggaatgcaccatctggggcaagccggccgagtgc
atctcagcgcgattccgaacctcggacggtagacagcacacgagcttgttgctctgcagc
ggcttctggggctggtctcgtcacgcaaactacgtaggggacttgttactcagttttagt
acgtgtgcactggtcggtagcacaaaggctgtggtgtggtggtatgctgtctggatgctt
gcgttgcttatccatcggtgcatgcgtgatgagaagaggtgctcggtaaaatacggagcc
gcctggactgagtactgcaagcgcgttccttggcgattcattcctggtatctggtaa

DBGET integrated database retrieval system