KEGG   Fusarium graminearum: FG03547.1Help
Entry
FG03547.1         CDS       T01038                                 

Definition
similar to reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
fgr  Fusarium graminearum
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    FG03547.1
Enzymes [BR:fgr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     FG03547.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 452 aa AA seqDB search
MEEYTVKQVVEHNKPDDAWLIIHGNVYDVSKYIRDHPGGADVLVEAAGLDASEDFDNAGH
SEDAFEIMEDLCVGKVKGFEKKKPKLKPLAPVTTPKAVTGKSSSLSALANITFVLAAGFG
AYYFGRRQELGVPNWVLASLRNDSTGSSFIKGVIVGSGSLAITNAVLAQRFTTSAMKSKP
FTSYPAHMKVPKRTQQDTLLQRGLLDPVVYSPLPLVKKTQVTPNVLHLTFSLPTTSTVLG
LPIGQHVTIKADVRGETVARSYTPVSNNSDLGILELVIKVYPDGKLTNNYLAHLEVGDEV
LFRGPKGAMKYQPNICKKIGLIAGGTGITPMFQVIRAVCEHDRDTTEISLIYANRTEQDI
LLREELDRFARRYPKNFKVYYMLDEPPSDWEHGSGYVTQELMKDKMPAPSMDSKVFLCGP
PGMVNASKKGLVDLGYQQPGASAKMSDQIFVF
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggaggaatatacagttaaacaagtggttgagcataacaaaccagacgacgcatggtta
ataatccacggcaatgtttatgatgtctccaaatatataagagatcatcctggtggcgca
gatgtcttggttgaggcagctggccttgacgcgagtgaagactttgataatgctggacac
tcagaagatgcatttgagatcatggaagatctctgcgttggcaaggtcaagggctttgag
aagaagaagcccaaactgaagccactcgcccctgtaacaacacccaaggccgtcactgga
aagtcttcttctctgtcagcgttagcaaacattacttttgttctcgccgctggcttcggt
gcatactatttcggtcgtcgtcaagaacttggtgtaccgaactgggtgcttgcctctttg
agaaatgactcgactggctcaagcttcatcaaaggcgtgatcgtcgggagtggatctctt
gccatcacaaacgcagtacttgctcagcgtttcactacttcagctatgaagagcaagcct
ttcacaagctatcctgcgcacatgaaggttccaaagcgaactcagcaagacacccttctc
cagagaggactgttagaccccgtcgtctattctcccctacctctagtaaagaagactcaa
gtcacgccaaatgtcctccacttgaccttcagtctaccaacaacgagcacggtgcttgga
ttgcctattggacagcatgtcacaattaaggctgacgtacggggagaaactgtcgctcgt
tcatacacgcctgtctcaaacaactcagaccttggcatccttgagctggttatcaaagtg
tacccggacggaaaactgactaacaattatctagctcaccttgaggttggagatgaagtt
ctctttcgaggtcccaaaggagcgatgaaatatcaacccaacatttgcaagaagatcggg
ctgattgctggcggcacgggtattacacccatgttccaagtcattcgcgccgtttgcgag
catgaccgtgacacgacagagatttccctgatctacgcaaataggacagagcaggatatt
cttttgcgggaggaactagacaggtttgccagacggtacccaaagaacttcaaagtttat
tacatgttagatgaaccgcctagcgattgggagcatggctcgggctatgtcacgcaggaa
ttgatgaaggataaaatgcctgctcccagtatggactccaaggtattcttatgtggtccg
ccagggatggtaaatgcatctaagaagggacttgttgacttgggctatcagcaacctgga
gcttcggcaaagatgtcggatcagatctttgtattttaa

DBGET integrated database retrieval system