KEGG   Fusarium graminearum: FG03795.1Help
Entry
FG03795.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
fgr  Fusarium graminearum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FG03795.1
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     FG03795.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 382 aa AA seqDB search
MKSLLALSLFAGLSVAQSSAWAQCGGEGFSGSTSCVSGYKCTVVNQWYSQCQPGTAEPPS
TTLKTTTGGGSTPTGTPGDGKFLWAGVNEAGGEFGEKNLPGTWGKDFIFPDPAAVDTLIS
QGYNTFRVQLKMERANPSGLTGAYDQAYIKNLTSIVNHITGKGATVLLDPHNYGRFFDKI
ITSTSDFQTWWKNFATLFKSNSRIMFDTNNEYHTMDQTLVLNLNQAAINGIRAAGATQYI
FVEGNQWSGAWSWPDVNDNMKALTDPENKLIYEMHQYLDSDSSGTSPDCVSTTIGVERLQ
AATKWLRANKKIGMIGEFAGGPNETCKTAVKNMLDFMKANTDVWKGFTWWSAGPWWGDYM
YSFEPPSGSAYQYYNSLLKTYV
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccctcctcgccctcagtctcttcgcaggtctctccgtcgcccaaagctcagcc
tgggcccaatgcggtggtgaaggcttctctggttccacatcctgcgtctcgggctacaag
tgcaccgttgtcaaccagtggtacagtcagtgccagcccggtactgctgagcctccctct
actaccctcaagactaccactggcggtggctctactcccactggaacacctggcgatgga
aagttcctctgggctggtgtcaacgaggctggtggtgagttcggagagaagaaccttccc
ggtacttggggcaaggactttatcttccccgaccctgctgctgtcgacaccctcatttct
cagggctacaacaccttccgtgtgcagctcaagatggagcgtgctaaccccagcggcttg
actggcgcctacgaccaggcttacatcaagaacctcacctccattgtcaaccacatcact
ggcaagggagccactgttcttcttgacccccacaactatggccgcttctttgacaagatc
atcacctccacctctgacttccagacctggtggaagaactttgctactctgttcaagagc
aacagccgcatcatgttcgataccaacaacgagtaccacaccatggaccagacccttgtt
cttaacctcaaccaagccgccatcaacggtatccgcgctgccggtgccactcagtacatc
tttgtcgaaggcaaccagtggtccggcgcctggtcgtggcccgacgtcaacgacaacatg
aaggctctgactgaccccgagaacaagctcatctacgagatgcaccagtacctcgactct
gacagctccggcacctcacctgactgtgtttctaccaccatcggtgtcgagcgtctccag
gctgctaccaagtggctccgtgccaacaagaagatcggcatgatcggagagtttgctggt
ggtcccaacgagacttgcaagactgctgtcaagaacatgcttgactttatgaaggccaac
actgatgtctggaagggtttcacatggtggtctgctggtccttggtggggtgactacatg
tacagcttcgagcctcccagtggctctgcgtaccagtactacaactcccttctcaagact
tatgtctaa

DBGET integrated database retrieval system