KEGG   Fusarium graminearum: FG03875.1Help
Entry
FG03875.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
fgr  Fusarium graminearum
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    FG03875.1
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     FG03875.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 651 aa AA seqDB search
MLGHLVFTLCLASSAIAAPDGAGLVSAPVVGKSLKVRALPNSPSGGYAPKVVDCPSTRPK
VRLADGLSDQEEAWVRRRRNNTIDPMTDLLSRVKISGFDAKTWIEKNKNNATALPNIAIA
ASGGGYRALMNGAGFISAADSRNNKTGPISGLLQSATYLAGLSGGGWLVGSIFANNFSTI
PDLQKGNRDSDIWAFDRSIFKGPERSGLGVLNTAEYWDDIKDAVDDKAEGWNTTITDWWG
RALSYQLIDASKGGPAYTFSSIADTSNFKDADTPFPILVSDGRAPGERIVSLNATVYEFN
PFEFGTWDPTTYGFAPTEYIGSNFTDGTVEKGGECVRGFDQFGYVMGTSSTLFNQFLLNN
ITKIGEENKIPSIVIKAIKGVLTDLDANDEDIADYSPNPFYKWDPTGKSYNAKDHQLTLV
DGGEDLQNIPLHPLIQPVRGVDIIFAVDSSADTDNNWPNGTALRATYDRVDSALGNGTQF
PSIPSAETFINEKLNQRPTLFGCDANNFTLSDGRSPPPLVFYIPNAPYTFQSNVSTFDLS
YSIPERDSIILNALNGATQGNATIDKEWPTCVVCAIMSRSWWKANETVPKECSTCFDRYC
WDGKTNNTAVKTYEPNFIISNETAAAEDNAATAGFAPSWFLGLDMSPISRI
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgcttggccatctcgtctttacactatgcctagccagctcggccatcgctgctccggat
ggcgcgggtttagtctcagcaccagttgttggcaaatccctcaaagtccgggctcttcca
aactctccaagtggtggttatgcgccaaaagtggttgactgcccctcgacacgccctaaa
gtccgccttgccgatggcctttcagaccaggaagaggcctgggtccgacgccgaagaaac
aacacaatcgacccgatgacagatttattatcccgagtgaaaatctcaggttttgatgcc
aaaacgtggatcgagaaaaacaaaaacaacgcgactgcgcttcccaacatcgccatcgcg
gcttctggtggtggctaccgagcgttgatgaacggagcaggttttatctctgctgctgac
tcacgcaacaacaagactggccccatcagcggcctcttacagtctgctacgtatctggct
ggtctgtcaggaggtggttggctcgttgggtctatctttgccaacaacttctccacaatt
ccagacttgcaaaaaggtaacagggattcggatatctgggcgtttgaccgttccatcttc
aaggggcccgaaaggtcaggtctcggcgtcttgaacacagctgaatactgggatgacatc
aaagacgccgttgacgacaaggccgaggggtggaatactacaatcactgactggtgggga
cgtgctctgtcttaccagctgatcgatgcctccaaaggcggtcctgcgtataccttctcc
tccatcgcggatacatccaacttcaaagacgcagatactccattccctatccttgtttct
gatggccgtgcccccggcgaacgtatcgtttcactcaacgcaactgtatacgagttcaac
cccttcgagtttggaacgtgggatcccaccacttatggttttgctcctacagagtacatc
ggctctaactttacagacggaactgtcgaaaagggtggcgaatgtgtccgcggctttgat
cagtttggctatgttatgggcacatcctctacattgtttaaccagttcctgctcaacaac
atcaccaagattggagaagaaaacaaaattccttccattgtcattaaggccatcaagggc
gtcctgacagatctggatgccaacgatgaggatatcgctgactattcccccaacccattc
tacaagtgggacccaaccggcaaaagctacaatgccaaggaccatcagttgactcttgtc
gacggaggagaggatctgcagaatatcccccttcaccctttgattcagcctgttcgaggt
gtcgacatcatttttgctgtcgattcttcagcagataccgacaacaactggcccaacggc
actgctcttcgtgcgacatatgaccgtgtcgactccgcattgggaaatggaactcagttt
ccctcgatcccctcagctgagacattcatcaacgagaagttaaaccagcgccccacactg
tttggttgtgatgcaaacaacttcacactttcagacggtcgatctcctcctcctcttgtt
ttctacattcccaacgcgccatacactttccagagcaatgtttccacctttgatctctcg
tacagcatccctgagcgtgacagcatcattttgaatgctttgaatggtgctactcaggga
aatgctacgattgataaggaatggcccacatgtgtcgtctgtgccatcatgagccgaagt
tggtggaaggccaatgagactgttcccaaggaatgcagcacatgttttgacagatactgc
tgggacggaaagacgaataatacagctgtcaagacatacgaacctaactttatcatttcc
aacgagactgcagcggcagaggacaacgcggccactgccggtttcgcgcctagttggttt
ttgggtttggatatgtcgcccatctcaaggatataa

DBGET integrated database retrieval system