KEGG   Fusarium graminearum: FG04126.1Help
Entry
FG04126.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
fgr  Fusarium graminearum
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:fgr00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:fgr00232]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 302 aa AA seqDB search
MPYVSAARYGKDNVRVCKVDRDSSTGVQTVTEMTVCCLLEGEIETSYTQADNSVVVATDS
IKNTIYITAKENPVNPPELYASILGSHFIEKYKHIHVANVSVKTVRWARLDVDGKPHPHS
FFKDGEETRNVEVRVSRQEGIEIKSSLVGLTVLKSTGSAFHGFVRDEYTTLPETWDRIFS
TDVDATWKWKKFDSVDAVKQFAPKFDTVREAARNITLKTFAEDASASVQATMYKMSDLIL
ESVPEVATVTYSLPNKHYFEIDLSWHKGIKNTGKDAEVYAPQSGPNGLIKCEVSRDSLQS
KL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgccttacgtatctgctgctcgctacggcaaggacaatgtccgcgtctgcaaggttgac
cgcgattcttctaccggtgttcagaccgtcacagagatgaccgtctgctgtctcctcgag
ggcgagattgagacctcgtacacacaggccgataacagtgttgtcgttgccacagactct
atcaagaacaccatctacattaccgccaaggagaatcctgtcaacccccctgagctgtac
gcttcaatcctcggcagccactttattgaaaagtacaagcacatccatgtcgccaatgtc
agcgtcaagactgttcgctgggcgcgtcttgatgttgatggcaagccccatcctcacagc
tttttcaaggatggcgaggagacccgaaatgtcgaggtccgagtcagccgacaggaaggt
attgaaatcaagagctctctcgttggtttgaccgttctcaagagcaccggttccgctttc
catggctttgtccgcgacgagtacacaacacttcctgagacatgggaccgtatcttctca
acggatgttgatgctacctggaagtggaagaagttcgattctgttgatgctgttaagcaa
tttgctcccaagttcgacaccgtgcgtgaggcggcacgcaacatcaccctgaaaaccttc
gccgaggacgcgagtgctagtgtacaagccaccatgtacaagatgtcggatcttatcctc
gaatctgtgcctgaagtcgcgacagtcacttattcactacctaacaagcattactttgag
attgaccttagctggcataagggaatcaagaacacaggcaaggatgccgaggtctatgct
cctcagtccggccccaatggtctcatcaagtgcgaagtctctcgagacagtttgcaatca
aagctttga

DBGET integrated database retrieval system