KEGG   Fusarium graminearum: FG04152.1Help
Entry
FG04152.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
fgr  Fusarium graminearum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:fgr00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 563 aa AA seqDB search
MSSPQANESDPLLSGSGHDRSDTQAESKAHRNSRLRELGLFAWALIATAAVIVVAIWTQH
EQQTKHDHNTPATKRNLVFMVSDGMGPATLSLTRSYRQHVEDLHFGDTLTLDKHFWGTSR
TRSNSSLVTDSAAGATAFSCGKKTYNGAISTLPNHDPCGTVLEAAKRAGYHTGLVVTTKI
EDATPACFNSHVVLREMEDEIALQQIGEGVLGRTVDLMLGGGRCNYLPSSAEGSCRADDT
DVVKIAKEKHNWTYADDRAGFDALKGGNNVKLPFLGLFASSDIPFEIDRRNHNDVYPSLS
EMAKTALRALEKATEKSDKGFFIMIEGSRIDHAGHINDPAAQVHEVLEYDKTFRAVLDFI
KESKTETVLVATSDHETGGLATALQEPGHLPVYNWYPKVLANATASAEWLHAKLNAHIAS
NSEAKKNKEKLKEYINEELIIRGLGISNASDKEITTIAEHPESALVLFSALISLRAHIGW
STHGHTAVDVNIYSSGGPRTENIRGNVENTDVGKYLREYLEVDVDAITEELQDKMSKIKV
QDAGMEALDEVWPLGNKHHAIQG
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctcctcaggccaacgaaagcgatcctctcttgtccgggtccggtcacgaccgc
tccgatacccaggccgaaagcaaggcccatcgaaactcgcgtctccgtgagctcggcttg
tttgcctgggctttgatcgctacagccgctgttattgtcgtcgctatctggacccaacat
gagcagcagacaaagcatgaccacaacacacctgccacgaagcgaaatctcgtcttcatg
gtgtcagatggcatgggccccgctacattgtccttgactcgcagctaccgacagcacgtt
gaagatctccattttggcgataccctcaccctcgacaagcatttttggggcacgagcagg
actcgctccaatagctcccttgtcaccgacagcgctgccggtgccactgccttctcctgc
ggaaagaagacctacaacggtgccatttctactctgccaaaccacgatccttgcggaacg
gtcttggaagctgcaaagcgcgctggataccacactggtctcgttgtgactacgaagatt
gaggatgcgactccagcctgcttcaactcgcacgttgtgctccgtgaaatggaagatgag
attgctcttcagcagatcggagagggtgtactcggacgaaccgtcgacctgatgcttggt
ggtggtcgatgcaactacctgcctagcagcgcggagggcagctgccgagctgacgatacc
gacgtggtcaagattgcaaaggagaagcacaactggacctacgctgatgaccgggctggt
tttgatgctctcaagggcggcaacaatgtgaagctgcctttcctcggactgtttgcgtca
agcgacatccccttcgagattgaccgccgaaaccacaacgatgtctacccttcgctgagc
gaaatggccaagactgctcttcgtgctcttgagaaggctactgagaagagcgacaagggc
ttcttcatcatgattgagggcagccgaatcgaccatgctggtcacatcaatgatcccgcc
gctcaggtccacgaggttcttgagtacgacaagaccttccgagctgtcctcgacttcatc
aaggagagcaagaccgagactgttctcgttgcaaccagtgatcacgaaacaggtggcctt
gctaccgcgcttcaggaacctggccacctccctgtttacaactggtaccccaaggtcctt
gccaacgcgactgcctcagctgagtggctccacgcgaagctcaacgcccatatcgcctcg
aactctgaggccaagaagaacaaggaaaagctcaaggagtacattaacgaggaactcatt
atccgtggtctcggtatctccaacgcctcagacaaagagatcaccaccattgcagagcac
cctgagagcgcccttgtcctcttctcggctctcatttctctgcgtgcacacatcgggtgg
agcactcacggccataccgcagttgatgtcaacatctacagctctggtggaccccgaaca
gagaacatccgcggtaacgtggagaacactgacgtgggcaagtatctgcgcgagtacctc
gaggttgacgtcgacgccatcaccgaggaattgcaggacaagatgagcaagatcaaggtt
caggatgcaggtatggaagccctcgatgaggtatggcctcttggaaacaagcaccacgct
atccagggttaa

DBGET integrated database retrieval system