KEGG   Fusarium graminearum: FG04254.1Help
Entry
FG04254.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
fgr  Fusarium graminearum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 502 aa AA seqDB search
MAGGTPGGEPTVGSGEPRLKSLATPETIKTGCIAWVEKEGQPRRAEILSIKTTKSGKQFY
CNFDNFNKRLDEWVPVIRLDFTREVEWPNPEKEKPKDPKAKKAPTVQSKKTQPSKKSQKR
PSKREQSTTSEANTPHPWTDFVENQNRQKSASIGPDGDSQARASVDGGETPGGGDEMEVD
ERETEVKREPAEFSREVEIEKLRTSGSMTQNPTEVSRIRNISKVQFGRFDLYPWYFSPYP
EIFSQEDVIFICEFCLSYYGDLKAFTRHRKKCTLQHPPGNELYRNEEISFFEIDGRRQRT
WCRNLCLLSKMFLDHKTLYYDVDPFLFYVMTVRTEKGCHMVGYFSKEKESADGYNVACIL
TMPQYQRKGYGRLLIQFSYELSRIEGKLGSPEKPLSDLGLLSYRQYWSENILEFLMGYNE
RDEKVTIEAISTALAMTTQDVEHTLQALRMQVYHKSDHKIVIPEKLIEQREKTKLKRKRT
VDPTKIQWKPPVFTASSRTWGW
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggctggcggtacacctggaggcgagcccaccgtgggctcaggtgagccgcgattaaaa
agccttgcgacacccgaaacgatcaagactgggtgcattgcctgggtcgagaaagaaggc
cagccacgacgcgccgaaattctcagcatcaagacaaccaagagcggcaaacaattttac
tgcaattttgataacttcaataagcgactggatgaatgggtacctgtcatcagattggac
tttactcgggaggttgaatggccaaaccccgaaaaggaaaagcctaaagacccaaaggcg
aagaaagcgcccactgtgcaatccaagaagacacaaccttcaaagaagtctcaaaaacgg
cccagcaaacgagagcaatcaactacgtcggaagccaataccccacatccttggactgat
ttcgtggagaaccaaaaccggcaaaagtctgcctcgatcggccccgatggcgatagtcaa
gcacgcgccagcgttgatggcggcgaaacacctgggggaggtgacgaaatggaggtggac
gaaagagaaacggaagtcaaaagggagccagcagagttcagtcgtgaggtcgagattgag
aagcttcgcacatccggctccatgactcaaaatccaaccgaagtctcacgaatccgaaat
atctccaaggtacaatttggccgtttcgatctgtatccatggtatttctcgccatacccc
gagattttcagtcaggaagatgtcattttcatctgtgaattctgtctgagctattatgga
gacttgaaggctttcactcggcaccgaaaaaagtgcacactacagcacccacctggaaac
gaactttatcgaaatgaggaaatatccttcttcgaaatcgatgggcgacgacagcgaacg
tggtgtcgcaacctttgtcttttgtccaagatgtttcttgaccacaagacactgtattat
gatgtggaccctttcctgttttatgtcatgacggtgcgaaccgaaaaaggatgtcacatg
gtgggatatttctccaaggagaaagagagtgcagacgggtacaacgttgcttgtattctg
actatgcctcaatatcagcgcaaaggctacggccgacttctgatccagttctcgtacgag
ctctctcgaatcgaaggaaagcttggctcccctgaaaagccactgtcagatttgggcctg
ctgagttatcgacaatattggtcagaaaacattctggaattcctcatgggttacaacgaa
cgtgacgagaaagtcacaatcgaggcgatttctacagctctggccatgacaacacaggat
gtcgagcacactctccaagcattgcggatgcaggtctaccacaagagtgaccacaagatt
gtgatacccgagaagttgatcgagcaacgcgaaaagaccaaactgaagaggaagcgaacc
gtggacccaaccaagatccaatggaaacctccagtattcacagcttcaagccgaacatgg
ggatggtaa

DBGET integrated database retrieval system