KEGG   Fusarium graminearum: FG04313.1Help
Entry
FG04313.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
fgr  Fusarium graminearum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:fgr00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 707 aa AA seqDB search
MASIVKNSSNSLDPNQANGAAGDIPNDGTGVVKLDPWLEPFSGALKRRYSKAQDWIKTIN
AAEGGLEKFSRGAEKFGFNVDANNNIVYREWAPNATAAYLIGDFNGWNRGAHPMKKNDFG
VFEITLPAQNGQAAIPHNSKLKISLDLPSGEHVDRLPAWIKYVTQDLSVSPAYDARFWNP
PASETYKFKNSRPKKPASARVYEAHVGISSPEQKVASYKEFTKNMLPRIKALGYNVIQLM
AVMEHAYYASFGYQINNFFAASSRYGTPEELKELIDTAHGLGITMLLDVVHSHASKNVLD
GINEFDGTDHQYFHGGGKGRHDQWDSRLFNYGHHEVMRFLLSNLRFWMDEYQFDGFRFDG
VTSMLYVHHGMGTGFSGGYHEYFGSDVDEEAVVYMMLANEMLHQLYPEVITIAEDVSGMP
ALCVPLSLGGIGFDYRLAMAIPDMWIKILKEVKDDEWDIANICHTLTNRRHGEKTIAYAE
SHDQALVGDKTLMMHLCDAEMYTHMSTLSPLTPVIDRGMALHKMIRLVTHGLGGEGYLNF
EGNEFGHPEWLDFPREGNNNSFWYARRQLNLTDDPLLRYKFLDNFDRMMNQTEAKYGWLS
APQAYISLKHEGDKVIVFERAGLVFIFNFHPTNSFSDYRIGIEVPGTYRVVLNSDHGDVG
GHNRIDENTRFFTTPMEWNNRKNWTHVYIPSRTAIILALESTVTQSS
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaatcgtcaagaattcatccaattctttggaccccaatcaggcaaacggtgct
gctggcgacattcccaatgatggtacaggcgttgtcaagctcgatccttggctggagccc
ttcagcggagctctgaagagacgatattcgaaagcacaagattggatcaagaccatcaat
gccgccgaaggtggccttgagaagttcagcaggggcgctgaaaagttcggatttaatgtc
gatgccaacaacaacattgtgtaccgcgagtgggcacccaacgctactgctgcgtacctg
atcggcgactttaacggctggaatcgtggcgctcaccccatgaagaagaacgatttcggt
gtctttgagattacactccctgcccaaaatggccaagctgccattcctcacaactccaag
ctcaagatttctcttgacttgcccagtggtgagcatgttgatcgacttcctgcttggatc
aagtacgtgacacaggacctgtccgtatctcccgcatacgatgcccgtttctggaaccct
ccagcttccgagacctacaagttcaagaactctcggcccaagaagcctgccagtgctcgt
gtatacgaagcacatgtcggtatttccagccccgagcagaaagtcgcatcttacaaggag
ttcaccaagaacatgctccctcgtatcaaggctcttggatataacgtgattcaattgatg
gctgtcatggaacatgcgtactatgccagcttcggatatcaaatcaacaacttcttcgca
gccagcagtcgatatggaactcctgaagaactgaaggagctcattgacaccgctcacggc
ttggggataactatgctactcgatgttgtccacagtcacgcgtccaagaacgtccttgat
ggtatcaacgagttcgacggtaccgaccaccagtacttccatggtggtggcaagggtcga
catgaccagtgggacagccgcctgttcaactacggacatcatgaggtgatgaggtttctg
ctgagcaacttgcgattctggatggacgagtaccagttcgacggtttccgattcgatggt
gtgaccagtatgctttacgttcatcacggcatgggaactggcttttcgggtggctaccat
gagtactttggctcagatgttgacgaggaggctgtcgtttacatgatgcttgcaaacgag
atgttgcatcagctttaccctgaggttatcacaattgccgaagatgtctctggaatgcct
gctctttgcgtgccactgtcacttggtggcattggctttgattatcgccttgccatggca
attcctgatatgtggatcaagatcctgaaggaagtcaaggatgacgaatgggatattgcc
aacatctgtcacaccctgaccaaccgccgacatggcgagaagactatcgcttatgctgag
agtcatgaccaagccctcgtcggtgataaaacactcatgatgcatctctgcgatgccgag
atgtacacccacatgtcgaccctctcgcccttgactcccgtcattgatcgtggtatggcc
cttcacaagatgatccgactggtgacacacggacttggaggagagggataccttaacttt
gagggcaacgagttcggccaccctgaatggctcgacttccctcgagagggcaacaacaac
tcattctggtacgctcgacgacagctcaacctcacagatgatcctctgcttcgatacaag
ttcctcgacaactttgaccgcatgatgaaccaaaccgaggccaagtacggctggttgtct
gcgcctcaggcgtacatctcactgaagcatgagggtgacaaggttatcgtgttcgagcga
gctggcttggtcttcatcttcaacttccaccccaccaacagcttcagcgactaccgtatt
ggaattgaggttccaggaacataccgtgtggttcttaactcagaccacggagatgtcgga
ggccacaaccgcatcgatgagaacactcgattcttcactacacctatggaatggaacaac
agaaagaactggacgcacgtctatattccttctcgaactgctatcattctggctcttgag
tctactgtcactcaaagctcctaa

DBGET integrated database retrieval system