KEGG   Fusarium graminearum: FG04416.1Help
Entry
FG04416.1         CDS       T01038                                 

Definition
similar to related to pyruvate dehydrogenase kinase isoform 2, mitochondrial
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
fgr  Fusarium graminearum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 414 aa AA seqDB search
MSWRASERLMDTIRHYARFPATGVSLRQMVQFGEKPSVGTLFRASQFLAEELPIRLAHRV
QELDELPDGLNEMPSVIKVKDWYAQSFEVSIGRNAFRLPAATPNPSIDEGESDGWGGLQN
NNSKNKGLTRRYFAVVDDSSDWPADLHLYNQRFAQTLHQIKRRHDSVVTTMAQGILEYKR
RRQRMQIDSTIQSFLDRFYMSRIGIRMLIGQHIALTDQSHHRDPTYVGIICTRTNVQDLA
QEAIENARFVCEDHYGLFEAPKVQLVCNPNLNFMYVPGHLSHMLFETLKNSLRAVVETHG
MEKQAFPVTKVIVAEGKEDITIKISDEGGGIPRSAIPLVWTYMYTTVDRTPSLDPDFDKS
DFKAPMAGFGYGLPISRLYARYFGGDLKLISMEGYGTDVYLHLNRLSSSSEPLQ
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggagagcttcggagcgtctgatggacaccatccgtcactatgctcgctttccc
gccactggcgtcagcttgcgccagatggtgcagtttggcgagaaaccctcagtcggcact
ttattccgagcttctcagttcttagccgaggagcttcctatccgtctagctcatcgcgtg
caagaactcgacgagcttccagatggcctcaatgagatgccgtctgtaatcaaggttaaa
gattggtatgcccaatcgttcgaggtatctatcggtcgcaatgctttccgtcttcccgcc
gcaacccccaatccatccattgacgaaggcgagtccgacggctggggcggtctccagaac
aacaacagcaagaacaagggtctcacacgccgatactttgcagttgttgatgactcaagt
gactggcccgccgatcttcacctgtacaaccaacgtttcgctcagaccctgcaccaaatc
aagcgccgtcatgatagcgtcgtcaccaccatggcccagggtatcctcgaatacaagcgc
cgtcgccagcgcatgcaaattgacagcaccatccaatcgttcctcgatcgcttttacatg
tcccgtatcggtatccgtatgctcatcggccagcacattgccttgacagaccagagccat
catcgcgaccccacctatgtcggtatcatctgcacaagaaccaacgtccaagatctagcc
caagaagccattgagaacgcccgtttcgtctgcgaggatcactacggtctcttcgaagcc
cctaaggtccaactcgtctgcaaccccaacctcaactttatgtacgttcccggccatctg
tcgcacatgctcttcgagaccctcaagaactcgctgcgcgccgttgtcgagacccacggc
atggagaagcaggctttccctgttacaaaggttattgtcgcagagggcaaagaggatatc
accatcaagatctctgacgagggtggcggtattccccgaagcgccattcctcttgtttgg
acttatatgtacaccactgtcgaccgcacaccgagcttagatcccgattttgacaagagc
gacttcaaggccccaatggctggttttggttatggattgcccatctcacgtttatacgcc
cgctactttggtggtgacttgaaactcatcagcatggaaggatacggtaccgatgtctac
ctccacctcaaccgtttatcctcgtcctccgaacctctccaatag

DBGET integrated database retrieval system