KEGG   Fusarium graminearum: FG04980.1Help
Entry
FG04980.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
fgr  Fusarium graminearum
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    FG04980.1
  Lipid metabolism
   00062 Fatty acid elongation
    FG04980.1
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     FG04980.1
Lipid biosynthesis proteins [BR:fgr01004]
 Fatty acid synthase
  Component type
   FG04980.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 324 aa AA seqDB search
MLYPSLLRLGFAIGALAGHGHAAPAHTNDDLTDTPLPVVVWHGLGDQFNSDGMKGIEELA
EAINPGTFVYIISLNGDPSQDRSATFTGNVTDQISQVCEELSKHPILSTAPAIDAIGISQ
GGQFLRGYVERCNWPQVRSLVTFGSQHNGIVKFKACGQNDWLCKGAMALLRFNVWSNFVQ
SRLVPAQYYRDPSTEQDYNNYLENSNFLADINNERELKNVKYKANLGSLTNFVMWMFEDD
TLVVPKESSWFEEVNGTESIPLRARKLYQEDWLGLRGVDRNGGLHFRSAPGDHLQGMDEL
LNQTFTDYFGPWKRSFSEDVWQEL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgctttacccttccttgctccgtcttggctttgccatcggagctctggctggtcatggc
cacgcggcacctgcacacaccaatgacgacctcactgatactcccctccccgttgtcgtt
tggcacggtctgggtgaccagttcaacagcgacggcatgaagggcatcgaagaactcgcc
gaagccatcaaccccggtacttttgtttacatcatttcccttaacggagaccccagccaa
gatcgctctgctacctttactggtaatgttacagatcagatcagtcaggtttgtgaggag
ctttccaagcacccaatcctctctacagcacccgctatcgatgccatcggtatctcccag
ggtggtcagttcctgcgtggctatgtcgagcgatgcaattggccgcaagtccgtagtctt
gttacctttggcagccagcacaatggtatcgtcaagttcaaggcttgtggtcagaatgac
tggctctgcaagggtgccatggctcttcttcgattcaacgtctggagcaactttgtgcag
tcacgtctcgttccagcccagtactaccgcgatcccagtaccgaacaggattacaacaac
tacctcgaaaactccaactttcttgccgacatcaacaacgaacgcgagctcaagaacgtc
aagtacaaggcgaacctcggcagtttgaccaactttgtcatgtggatgtttgaggacgat
acactggttgtgccaaaggaatcttcatggttcgaggaggttaatggcacagagagtatt
cccctccgagctcgcaagctctaccaggaggactggcttggcctccgaggcgtggatcgc
aatggtggtcttcacttccgaagcgcccctggtgatcatctccagggtatggacgagttg
ctcaaccaaacctttacagactactttggtccctggaagcgaagtttctcggaggatgtt
tggcaggagctgtag

DBGET integrated database retrieval system